(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGD

AM286690.ALGD        Location/Qualifiers
FT   CDS_pept        432756..434069
FT                   /transl_table=11
FT                   /gene="algD"
FT                   /locus_tag="ABO_0384"
FT                   /product="GDP-mannose 6-dehydrogenase"
FT                   /function="produces a precursor for alginate
FT                   polymerization. gdp-mannose + 2 nad(+) + h(2)o =
FT                   gdp-d-mannuronate + 2 nadh."
FT                   /EC_number="1.1.1.132"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15832"
FT                   /db_xref="GOA:Q0VSL6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSL6"
FT                   /protein_id="CAL15832.1"
FT                   /translation="MSTISIFGLGYVGAVCTACFAKKGHTVIGMDVSEGKVGQVQRGES
FT                   PIVEEQLAELLSEGVAEGRISATTDARQAVFDSQVSFICVGTPSDENGFLNTCYLKTVC
FT                   EDIGLALRDKDDTHLVVIRSTVLPGLVRGDLLPILEKASGKKAGVDFMLAVNPEFLRES
FT                   TAIYDFFNPPMTVVGGIDDEASDALAVLYQGLDAPMIKMTIEEAELVKYACNSWHATKV
FT                   SFANEIGNIAKQAGVDGRRVMEVVCMDNKLNLSSYYMKPGFAYGGSCLPKDVRALNAWC
FT                   DKESLTSPLLASLSTSNDNQVERAMAMIRESGMKKIGLLGLSFKPGTDDLRESPLISLA
FT                   AKLLSEGYRLAIYDSNVNYASKNSPVAEQLWNSYGELFECLVEDMDQLVDGSEVVVLGH
FT                   ATPTFKAVADTVNSGRLLIDLCGYLPGVSSEDRQGICW"
     atgtccacta tctcaatttt tgggctgggc tatgttggcg cggtctgcac ggcatgtttt        60
     gccaagaaag gtcacacggt tattggcatg gatgtcagcg aggggaaggt gggtcaggtc       120
     cagcgcggag agtcgccgat tgtcgaagag cagctcgcgg agttgttgtc tgagggggta       180
     gcggaaggtc ggattagcgc gactacagat gcccggcagg ccgtgttcga cagccaggtg       240
     tcctttatct gcgtagggac gcccagcgat gagaacggct ttcttaatac ctgttatttg       300
     aaaacggtgt gtgaggatat cggccttgcg cttcgagaca aagatgacac tcaccttgtg       360
     gtgatccgca gcacggtgtt gccaggactg gtgcgcggcg atctgctacc gattctagag       420
     aaggcttcgg gtaaaaaggc tggggtcgat tttatgctgg cagtaaaccc ggagtttctc       480
     cgtgagtcca ctgccatcta cgactttttc aatccgccga tgacagtggt tggcggcatc       540
     gacgacgaag cctccgacgc ccttgctgta ctctatcagg gactagatgc ccctatgata       600
     aaaatgacta ttgaggaagc agaactggtg aaatatgcct gtaattcctg gcatgccacc       660
     aaggtgtcat ttgctaatga gatcggcaat atcgccaagc aggcgggtgt cgatggacgt       720
     cgggtcatgg aagtggtgtg tatggacaac aagctgaatc tgtccagcta ctacatgaag       780
     cccgggtttg cttatggtgg ctcctgtctt cccaaggatg ttcgggcgtt aaatgcttgg       840
     tgtgacaagg agtcattgac gtcaccactg ttggcatcac tgtctaccag taacgataac       900
     caagtagagc gggccatggc catgattcgt gaatctggca tgaaaaagat tggtctgctg       960
     ggtctcagct tcaagccggg tactgatgat ttgcgggaaa gtccgctaat cagtcttgcg      1020
     gcaaagctgc tgtcagaggg gtaccgcctg gctatctacg atagcaatgt caactatgcc      1080
     agcaagaaca gcccggtggc cgagcagctt tggaatagtt atggcgagct gttcgagtgt      1140
     ttagtcgaag acatggatca actggtggat ggcagtgaag tcgttgtgct tggtcatgct      1200
     acccccacat tcaaggcggt ggcagatacc gtaaatagtg gccgtttgtt gatagacctg      1260
     tgtggttacc tgccaggagt gtccagcgaa gatcgccagg gcatctgctg gtaa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page