(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGG

AM286690.ALGG        Location/Qualifiers
FT   CDS_pept        complement(445011..446306)
FT                   /transl_table=11
FT                   /gene="algG"
FT                   /locus_tag="ABO_0394"
FT                   /product="Poly(beta-D-mannuronate) C5 epimerase
FT                   [Precursor]"
FT                   /note="alginate-C5-mannuronan-epimerase AlgG, putative);
FT                   identified by sequence similarity"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15842"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSK6"
FT                   /protein_id="CAL15842.1"
FT                   /translation="MKTFLAALLVMLTFQPALAAVQLTPIYANEASNWPLETFASNGLF
FT                   RQIARYQQGHPQAIVLNGGEYTLAQLARQLDTRALSRTASGWTLHYPLIIGPGARLILS
FT                   ASTLFIEGRHGGCLINRGKLLIDNSSLSSNGDQNSGFIHGWGGSTTRIKNSVLADLGRA
FT                   DYRANGVSVARHRYQGAGAPAQLFIHDSRFSNLHRGVDAEAGSRVSIVNLSISASREQG
FT                   VVLYNSPAHIERLQVNDSKGHGLRAGGNRTISIADSQLQNNGGSGLLLEDHTGEIHISQ
FT                   VASLNNQEYGIQIKSQRGQQITLMDTLNLNGNGSDGLRLDGSMHITLNSADISHNQRYA
FT                   ISIQAEDGRQITGNMAELHLHLNRLAALHTGGEGSLQLKRVSLRHRSNQGKYLAGNLAG
FT                   KEADLLPTLLQTQEVVVPFTESLATIPLTSPL"
     atgaagacat ttctcgctgc actgttagtc atgctgacat tccagcccgc cctggctgca        60
     gttcagctga cgcccattta cgcaaacgaa gccagcaatt ggcctctcga gacttttgcc       120
     agcaacggtc tattccgaca gatcgcccga tatcaacaag gccatcccca agccatcgtc       180
     cttaatggcg gcgaatacac gcttgcgcaa ttggctcgcc agctggacac ccgcgccctt       240
     agccgaacag catccggctg gacgctgcac tatccgctga taattggtcc cggcgctcgg       300
     ctgatcctct ccgccagcac tttgtttata gaaggtcgtc acggcggctg cctgatcaac       360
     cggggcaagc tgctcattga taacagttcc ctgtccagta acggcgatca aaacagtggc       420
     tttatccatg gctggggcgg ctcgactacc cgaatcaaga atagcgtctt ggcagacctt       480
     ggccgtgccg attaccgagc caacggggtc agcgtagcac gccatcggta tcagggcgca       540
     ggcgctcctg cgcaactgtt cattcacgat tcccgtttca gcaacctcca ccgaggcgta       600
     gacgcagaag caggcagccg cgtcagcatt gtcaatctct ctatcagtgc cagccgagag       660
     cagggagtcg tgctgtacaa cagcccagcc cacattgagc gattacaggt caacgattca       720
     aaagggcatg gcttgcgcgc gggcggcaac cgcaccattt ctattgccga tagccaactt       780
     cagaataatg gtggcagtgg cctgttactg gaggaccaca ccggtgagat acacattagc       840
     caagtggcca gcctcaataa ccaagaatac ggcatccaga tcaaaagcca gcgcggacaa       900
     cagattaccc taatggatac actgaacctg aacggcaatg gcagcgacgg cctgcggctg       960
     gatggcagca tgcacatcac cctgaacagc gctgacatca gccacaatca gcgctatgcc      1020
     atttccattc aagcagaaga cggtcggcag atcaccggca acatggcgga gctgcacctg      1080
     catctcaacc ggctggcggc cttgcatacc ggcggcgaag gctcgctgca gttaaagaga      1140
     gtgagtctgc gccatcgcag caatcaggga aaatatctgg caggtaacct ggccggcaag      1200
     gaagccgacc tattacccac gttgttacag actcaggagg tggtcgtccc gtttacggag      1260
     tcgcttgcca caatcccgct aacgagcccc ctgtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page