(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGI

AM286690.ALGI        Location/Qualifiers
FT   CDS_pept        439420..440838
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="ABO_0389"
FT                   /product="Alginate O-acetylation protein AlgI"
FT                   /function="AlgI is involved in acetylation of the alginate
FT                   polymer ."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15837"
FT                   /db_xref="GOA:Q0VSL1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSL1"
FT                   /protein_id="CAL15837.1"
FT                   /translation="MVFSSNLFVFLFLPLFLAAYYITPTRWRNWTILLGSYLFYAWWRP
FT                   DFLLLFVAITLWNYAFALLIQKYRDHPRCFYWLLLGVTGDLAALGYFKYANFGVESIST
FT                   LMLSVGLNPFFLETIILPLGISFYTFQALAYLVDVYRGDAKPTRSFINFAAFISFFPQL
FT                   IAGPILRYRNLERQFEKRTHSMALFSLGASRFLLGFIKKVLIADSIAPVATYLMAAPDP
FT                   GFVDSVFGVVISSLQLYFDFSGYSDMAIGLGMMMGFKFQENFNQPYTCQSVTEFWRRWH
FT                   ITLTQWLRDYLYRPLKRSLGWSVAVATFTTLTLAGLWHGADLSFVLWGASLGGMMVLER
FT                   WIGTVTTLSTPYSLWKNYRTMAFLWFIWPLFLAGNIDDAWRIMSGLLGMNGWGSLHNLS
FT                   LWVSPMTLFFCVVAMFWERASAYYNKRFYLGIDKSNVYQDVSGWRVPILWCGFALAVTR
FT                   LSAESFSPFLYFQF"
     gtggttttct cgtctaatct ttttgtcttt ctctttctgc cgctgttttt ggcggcgtat        60
     tacataacac cgacgcgctg gcgaaactgg actatcctgc taggaagcta tcttttttat       120
     gcttggtggc ggccggattt tctactgctt tttgtggcaa ttacgctgtg gaattatgcc       180
     tttgctctgc tgatacagaa ataccgggat caccctcgtt gtttttactg gttgttgctc       240
     ggggttactg gagacctggc tgcactaggg tatttcaaat atgccaactt tggtgtggaa       300
     agtatcagca cgttaatgct gtcagtgggg cttaacccct tctttcttga gacgattatt       360
     ctgccgttgg ggatttcttt ttatactttt caggcgttgg cctacttggt agatgtgtac       420
     cggggggatg ccaaacccac gcgcagcttt atcaacttcg ccgcgttcat ttcctttttt       480
     cctcagctta ttgctgggcc gattctgcgt taccgaaatc ttgagcgaca gttcgagaaa       540
     cgcacccatt ccatggcgtt attttctttg ggggccagtc gtttcctgct gggatttatc       600
     aagaaagtat tgattgctga cagcatcgcg ccggtagcaa cgtatctcat ggccgcccct       660
     gatccgggtt ttgtggatag tgtgtttggt gtggtgatat ccagcctgca actgtatttc       720
     gatttttccg gttattcgga catggctatc gggctgggca tgatgatggg cttcaagttt       780
     caggagaact ttaatcagcc ctatacctgc caaagtgtca ccgagttctg gcgacgctgg       840
     cacattaccc tgactcaatg gctgcgtgat tatctctacc gccccctgaa gagatccttg       900
     gggtggtccg tggcggtcgc cacgtttacc accctgactt tggcagggct gtggcacggg       960
     gcagatttgt cttttgtgct atggggggct tcgttgggtg ggatgatggt tctggagcgg      1020
     tggataggca cagtaaccac cctgtcgacc ccttactcgc tctggaagaa ctatcgcacc      1080
     atggctttcc tgtggtttat ttggccgttg ttcctcgccg gtaatataga tgatgcttgg      1140
     cggataatgt caggcctgct cggcatgaat ggctggggca gcctgcacaa tctttccttg      1200
     tgggtctccc ccatgacgct gttcttttgt gtggtggcga tgttctggga gcgggccagt      1260
     gcgtattaca acaagcgttt ctaccttggg atcgacaaga gcaatgtata ccaggatgtg      1320
     agcggttggc gcgtccctat tctgtggtgt ggttttgcgc ttgcggtgac gcgattgtct      1380
     gccgagtcgt tctctccctt tctttatttt cagttttga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page