(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGQ

AM286690.ALGQ        Location/Qualifiers
FT   CDS_pept        complement(279186..279686)
FT                   /transl_table=11
FT                   /gene="algQ"
FT                   /locus_tag="ABO_0259"
FT                   /product="Regulator of RNA polymerase sigma(70)"
FT                   /note="(AlgQ, AlgR2) (transcriptional regulator; Regulator
FT                   of RNA polymerase sigma(70)) identified by sequence
FT                   similarity; putative"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15707"
FT                   /db_xref="GOA:Q0VSZ1"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSZ1"
FT                   /protein_id="CAL15707.1"
FT                   /translation="MASSTSAALAQWQRIEALVQAWLDERQQLIVLLCTMQGLKGLSAV
FT                   QPNDNPQPIHRQVQRFCQLLMDYISAGYFEVYRELVNEARHFQRDNPTLTRQILAKLDR
FT                   STDAALAFNEDFEHPDQCLAQRDVLPERISALMETLEERFALEDQLILSIHQQDPPYQQ
FT                   ATH"
     atggcgagtt caacatctgc agcactggct caatggcaac gtatcgaagc actggttcag        60
     gcttggctgg atgaacgcca gcagctgatt gtgctgctct gcactatgca gggcttgaaa       120
     gggctttctg cagtccaacc caacgataac ccacaaccca tacaccgtca ggttcaacgc       180
     ttttgccaac tgttgatgga ttacatcagc gcaggttact tcgaggtata ccgagagcta       240
     gtcaatgaag cccggcattt ccagcgagac aacccgacac tgacccggca gattttggcc       300
     aagctggacc gctccactga tgcagctctt gccttcaacg aagattttga gcacccagac       360
     cagtgtttgg cgcaacgaga tgtgctacca gaacgcatca gtgcgctgat ggaaacccta       420
     gaagaacgct ttgcactgga agaccagctg atcctcagca tccatcagca agatccccct       480
     taccaacagg ccacacatta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page