(data stored in ACNUC7421 zone)

EMBL: AM286690.CARA

AM286690.CARA        Location/Qualifiers
FT   CDS_pept        346031..347155
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ABO_0317"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /function="2 ATP + L-glutamine + CO(2) + H(2)O = 2 ADP +
FT                   phosphate + L-glutamate + carbamoyl phosphate."
FT                   /EC_number="6.3.5.5"
FT                   /note="(carbamoyl-phosphate synthase small subunit,
FT                   carbamoyl-phosphate synthetase glutamine chain) identified
FT                   by sequence similarity; putative identified by match to
FT                   PFAM protein family HMMPF00988; putative InterPro:
FT                   Glutamine amidotransferase class-I"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15765"
FT                   /db_xref="GOA:Q0VST3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST3"
FT                   /inference="protein motif:HMMPFAM:HMMPF00988"
FT                   /protein_id="CAL15765.1"
FT                   /translation="MTVPAILALEDGSIFRGVAIGATGETVGEVVFNTAMTGYQEILTD
FT                   PSYAKQIVTLTYPHIGNTGVTAEDEESSRIWASGLVIRDLAMTVSNWRSEQSLSDYLRD
FT                   RNIVAIADIDTRRLTRILRDKGALNGCILAGESVDEAQALAAAKGFPGLKGMDLAKVVS
FT                   VAEPYSWTESTWDLEQGHTEQGETRFHVVAYDYGVKRNILRMLAERGCKLTVVPAQTPA
FT                   SEVLAMKPDGVFLSNGPGDPEPCDYAISAIQEIVGTGLPVFGICLGHQLLALASGAKSM
FT                   KMATGHHGANHPVKTLADDTVMITSQNHGFAVDIDTLPANLKVTHVSLFDGTLQGIERT
FT                   DVPAFSFQGHPEASPGPRDCAPLFDHFIELMEAK"
     ttgacggttc ccgccattct cgctcttgaa gacggaagca tctttcgggg tgttgcaatc        60
     ggtgccacgg gtgaaaccgt gggtgaggtg gtgtttaaca ccgccatgac tggctatcag       120
     gagatcctga cggatccttc ctatgccaag cagattgtaa cccttaccta tccgcatatt       180
     ggtaacactg gcgtcactgc cgaggatgaa gagtcctctc gaatctgggc ctccggcctg       240
     gtgattcgtg atctggccat gacagtgagc aactggcgta gtgagcaatc tctttcggac       300
     tacctgcgtg atcgcaacat cgttgccatc gccgatatcg acacgcgccg cttgacgcgc       360
     attttgcgtg acaaaggcgc cctaaatggc tgcattttgg ccggcgaaag tgtggatgaa       420
     gcgcaggcgc ttgctgcggc caaggggttt cctggcctga aaggcatgga cctggccaag       480
     gtggtgagtg ttgccgagcc ttatagctgg acagagtcca cctgggatct ggagcagggc       540
     cacaccgagc agggtgagac ccgcttccat gtggtggctt atgactacgg tgttaagcgc       600
     aacattctgc gtatgttggc cgagcgcggc tgcaagctca ccgtggtgcc ggcgcaaacg       660
     cctgcatccg aagtgctggc gatgaagccg gatggtgtct tcctgtctaa cggacccggt       720
     gatccggagc cctgcgacta cgcgatttcc gcgattcagg aaattgttgg caccggtttg       780
     cctgtgttcg gcatctgctt gggacatcag ttgctggcgc tggccagcgg tgccaaatcc       840
     atgaaaatgg ctaccggcca tcatggtgct aaccacccgg taaaaactct ggccgatgac       900
     acggtgatga ttaccagtca gaaccatggt tttgcggtgg atatagatac cttgccagcc       960
     aacctaaagg tgacccatgt gtcgctgttc gacggcacct tgcaaggtat tgagcgcact      1020
     gatgtgcccg ccttcagttt ccaggggcac ccggaagcga gcccggggcc gcgcgactgt      1080
     gcgccattgt tcgatcattt catcgagctg atggaagcga aataa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page