(data stored in ACNUC7421 zone)

EMBL: AM286690.CHEB

AM286690.CHEB        Location/Qualifiers
FT   CDS_pept        complement(105343..106374)
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="ABO_0103"
FT                   /product="protein-glutamate methylesterase"
FT                   /function="Chemotaxis response regulator containing a CheY"
FT                   /EC_number="3.1.1.61"
FT                   /note="(protein-glutamate methylesterase CheB) identified
FT                   by sequencesimilarity; putative InterPro: CheB
FT                   methylesterase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15551"
FT                   /db_xref="GOA:Q0VTJ2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ2"
FT                   /protein_id="CAL15551.1"
FT                   /translation="MTAPGRVGVIADSTLQGHLLSSAVKSQGYQVVVSTEPETLEDRWL
FT                   ETDALDLLVVDLSSEDRWQQFLDDLLERAEVPILFCDGQAPARTDVLYPKWERRLVTKL
FT                   VSFIGKPAAEERLEVIPARPPQVRIPQPREFHAIRPGDRPRQVWVLGASLGGPAAVKRF
FT                   LDCLPANLPVAFVLAQHIDGRFLDTLCGVLGRDNSIHCKIGVDGEALRHGELAIVPVKY
FT                   AVRFRHDGRIQSTGAPWEGPYAPSIDQVIQYGGEGFARACGAILFSGMGNDGAIAAPRL
FT                   AATGCPVWAQSAETCAVSSQPDSVRETGCVSFSGSPEQLALQLVERVRRELTQNPFPMH
FT                   PEY"
     atgaccgcgc ccgggcgtgt tggcgttatt gccgacagca cattgcaagg gcacctgctc        60
     tccagcgcag tgaaaagcca gggttatcag gtcgtagtca gcaccgaacc cgaaaccttg       120
     gaggatcgct ggctggaaac tgacgcgctg gatctgctgg tcgttgatct gtccagtgaa       180
     gatcgctggc agcagtttct tgatgacctg ctggagcgag ctgaagtgcc gatcctgttt       240
     tgtgacggcc aggcaccggc tcgcaccgac gtcctctatc ccaaatggga acggcgccta       300
     gtcaccaaac tggtgagttt tatcggcaaa ccggcagcag aagagcggct tgaggtaatt       360
     cccgcgcgcc cgccccaagt acgcattccc cagcctcggg agtttcatgc cattcgcccc       420
     ggcgaccggc cccggcaagt gtgggtactg ggcgccagct tgggcggacc ggccgcggtg       480
     aaacggtttc ttgactgcct gccggccaat ctgccagtgg cctttgttct ggcacaacac       540
     attgacgggc gctttctaga taccctgtgc ggggtgctgg gccgagacaa ctcgattcat       600
     tgcaagatcg gggttgatgg tgaagccctg cgccacggag agctggccat tgtgccggtg       660
     aaatatgcag tacgctttcg tcacgacggc cgtatccagt caaccggtgc accctgggaa       720
     ggcccctatg cgccgtccat cgaccaggtg atccagtatg ggggcgaagg ctttgctcgc       780
     gcatgcgggg ccattctatt ttccggaatg ggcaacgacg gtgctatcgc cgccccgcgt       840
     ctggcagcca ctggctgccc ggtatgggca caaagcgcag aaacctgcgc ggtcagcagc       900
     caaccggatt cggtacgcga aaccggctgc gtgagcttta gcggctcacc agaacaactt       960
     gcactacaac tggtggaacg agtaagaagg gaactgacac aaaacccatt cccaatgcat      1020
     ccagagtatt aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page