(data stored in ACNUC7421 zone)

EMBL: AM286690.CHPA

AM286690.CHPA        Location/Qualifiers
FT   CDS_pept        complement(106371..113381)
FT                   /transl_table=11
FT                   /gene="chpA"
FT                   /locus_tag="ABO_0104"
FT                   /product="two-component hybrid chemotactic sensor and
FT                   regulator, putative"
FT                   /note="ChpA two-component hybrid sensor and regulator,
FT                   putative identified by match to TIGR protein family
FT                   HMMTIGR01387 InterPro: Histidine kinase C-terminal still
FT                   frameshift probable component of chemotactic signal
FT                   transduction system"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15552"
FT                   /db_xref="GOA:Q0VTJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ1"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01387"
FT                   /protein_id="CAL15552.1"
FT                   /translation="MTGDVMSDRHDYLALDWVRGEIQETLNQAQQTLESFENNPNDTTR
FT                   MRFCQTHLHQVYGTLQMVEFYGAALFAEEMEKLAQALLNGSVSNVADSQETLMRAILQL
FT                   PPYLDRVASNRRDLPVVLLPLLNDLRAARGESLLSETALFKPDLSEATGQGQIRDDKLN
FT                   DPHFTQLAKKIRQMFQTALLGILRNDNIGKNLGYMAKVFTKLEQVTGDAPRAPLWSISN
FT                   ALVEGLSEDAIILGSSVKLMLGHVDRNLRELAVDGAASLNRPAPTDLIKNLLYYVAKAD
FT                   VDSPRIRDVQARFRLDEALPSDDLVNTERQRMTGPDAQAMSSVVQALSEELTTVKDTLE
FT                   HFVHSGDSDTSKLQPLTLTLKQVADTVAVLGLGQPRALVEEQLHAMEGIVAGKAPAERE
FT                   TLMDIAGALLYVEATLAGIGGDRRNASHNRQGDDMPSHVGQAMDAVLRECRAGLEEAKD
FT                   GIVEFIASQWNPEPLQEVPARLNAVRGGLEVIQLGKPALILQQCVQFIEEKLLAVDKPK
FT                   PDWRSMDTLADAITSVEYYLERLSDDPETTDDILQLARSSVEILGYPLLEEQNFVDSDV
FT                   KSIELATSDMGSSALEHDMDAWSGFTDKAEPQDNNSSNDEARINSPQEITLPAEPEEEP
FT                   QTPATAATETQAQDDDLIDDEIIEIFQEEVGEVLDALDQYFPRWVANTSDEESLVEFRR
FT                   AFHTLKGSGRMVGASTVGELGWSVENMLNRVIDRTIEPSAVLIALVQEVRNRVPALVDA
FT                   FTLRQTDPFDVQPLIDAADTLANGSQIRQVPTLAGAASNTTHSNDNAGILDDIVMDTTA
FT                   DATLDSPADAEYITLDNASENENLELTEPALSDSANCEPADNDLSTEDLAAFEAAASED
FT                   ALNPWETESSRDDVYLLPADNDPTGIDEGISLDLPEQEPADDADSDTSNASIESLSDIP
FT                   DMSCAPFEEDSNESGPDPMLLEIFSSEARRSLALIAQWLANNDTDLSEHPVDDGVHRAL
FT                   HTLMGSARMAEIEAVAEVAEPAEKLTRDLISSNRRANQQQITLLAKTHDLILASLDKIT
FT                   SRPPGHLPGADELVHSLNQQRDQLQDSSSNDPDPHILSIFLSEGMDLIVDSEPLLSQWA
FT                   QHPEHTDELVHLRDALERLANSAATSDLNEIHDLAAALTGCYSAVQSAHLAYSERLFTL
FT                   ASEGQEALMNMMDCLAAGQTVHAKQELVEALRKLTGGDDPNGSLADSSSDITLGSTVVV
FT                   TQRAEHTTDSHRYEAHMDPELMALFLEEAEEILESASHSLDQWEAGDNSNISSLQRDLH
FT                   TLKGGARMAGVAPVEDLAHELENLYESYNAGQLESHAALFHLLHQCHDSLAMMIENLQA
FT                   NTPPADHAEHSEQKNSLATPQPNTTGAPITIEDAPASIDVPPQPKRDPELVEIFLEEAD
FT                   EILESAGNSLELWISQQDNLIELQSLQRDLHTLKGGARMAEVPELGDLGHELETLYEGL
FT                   AQSQLAIEPSLFDLLHRCHDQLAEMVEALRTNQPLPNGGVLIAAIHDYMANPVTFALPA
FT                   LSAIQTVHPSPPSADVVEQNPPATSHESASSTPAADDAWQADSDPEILNIFLEESEELS
FT                   EIINACLTSWRDNPQSTDFTDDLKRALHTLKGGARLAGLKQLGDISHNFENYLLALERR
FT                   RQTPAPSDFQPMLRWHDQINRGMESVAAAARANTPAAQGANTTDQLNTLLTAPPQPAPQ
FT                   QPQKDARRQRQAQAQPQEMVRVGADVLEALVNLAGETSINRGRVEQGITEFAFNVEEMG
FT                   NTVQRLYEQLRRLDSETEAHIMSNYQKGVDLGEHDEDFDPLEMDQYSELHQIAKQLSES
FT                   ASDLLDLKNTLLDRNKDTETLLLQQARINTELQEKLMRTRMVPFSRLVPRLRRIVRQIS
FT                   GEVDKRVDFDVINPEGELDRSLMERVVAPLEHMLRNAVDHGIETGDARNAAGKNPTGHI
FT                   NLELGREGGEVVITLSDDGKGIDTDAVREKAIEQGLIAEDAQLCEQEIQQFIFHAGFST
FT                   AAAVTQISGRGVGMDVVASEIKQMGGSVAIDSHKGQGTRFIIRLPFTLAMNRALMVKAA
FT                   DDSYAIPLNQIEGIVRISPFELQHYFEEENPVYTYVGQDYQLQYLGHFVHGNRVPHLEN
FT                   QTTPMPVLLIRSTEHTVAIVVDELVGSREVVVKAVGPQLATIAGISGATILGDGSVVII
FT                   LDIHSLIRAAHVQTTALISDEAVPALPQEPEEEALPQRETPLVMVTDDSVTVRKVTTRL
FT                   LERNGYEVVTAKDGMDAIAKLEDIRPDVMLLDIEMPRMDGFEVASHVRHDSRLQNVPII
FT                   MITSRTGEKHRERAFDIGVNCYIGKPFQESELLSTIRELLGELQEVDNG"
     atgacaggag acgtcatgag tgaccgtcac gattatctgg ctctggactg ggttcgcggg        60
     gaaatccagg aaaccctgaa ccaagcgcag cagacattgg aatcgttcga gaacaatccg       120
     aacgacacca ctcgtatgcg cttctgtcag acccacctgc atcaggtgta cggcaccttg       180
     cagatggttg agttctacgg tgcggcactg ttcgccgagg aaatggagaa actagcccaa       240
     gccctgctca acggcagcgt gagcaatgtg gctgacagtc aggaaaccct gatgcgggcg       300
     atcctgcagc tgcccccgta cctagaccga gtcgccagca accgccgtga cctgccggtg       360
     gtcctgctgc cgctgctcaa tgatctgcgc gcagcgcgcg gtgaatcgct attgtcggaa       420
     accgccctat tcaagccgga cctcagcgaa gcaaccggcc aaggccagat tcgtgacgac       480
     aagctcaacg atccccactt tacccagctg gcgaaaaaga tccgccagat gttccaaacc       540
     gccctgctcg gcattctgcg taacgataat ataggcaaga acctgggcta catggccaag       600
     gttttcacca agctggagca agtcaccggc gacgcgcctc gtgcaccgct atggtcgatt       660
     agtaatgcac tggtagaagg gctttcagaa gacgccatta tccttggctc ttcggtgaaa       720
     ctcatgctcg gccacgtcga tcgcaatctg cgggagctgg ctgtggacgg cgccgccagc       780
     ctcaaccgcc ccgcccccac cgatctgatc aagaaccttc tttactacgt ggccaaagcc       840
     gacgtggaca gcccccgcat ccgtgatgtc caggcccgtt ttcggctgga cgaggcactg       900
     ccctccgatg acctagtcaa cacagagcgc cagcggatga ccggcccgga cgcccaggcc       960
     atgagctccg tggtgcaggc gctttccgaa gaactcacta ccgtcaaaga caccctggag      1020
     cattttgttc acagcggcga ctccgacacc agcaagctgc agccccttac ccttaccctg      1080
     aaacaggtgg ccgacaccgt ggccgtactg ggccttggcc aacctcgggc gctggtggaa      1140
     gaacaactgc acgctatgga aggtatcgtg gccggcaaag cacctgccga acgtgaaacc      1200
     ctgatggata tcgccggcgc gctgctctat gtagaagcaa ccttggcggg tatcggcggc      1260
     gaccgccgta acgccagcca caatcgccaa ggcgacgata tgcctagcca tgtaggccaa      1320
     gcgatggatg ctgtacttcg cgaatgccgc gctggactgg aagaagccaa agacggcatc      1380
     gtggaattca tcgcctcaca atggaacccc gagcccctgc aagaggtacc agcacgcctg      1440
     aatgccgtgc gcggcggtct ggaggtgatt cagctgggca aacccgcgct gattttgcag      1500
     cagtgcgtgc aattcatcga agaaaagcta ctcgccgtag ataagcccaa gcctgactgg      1560
     cgcagcatgg acaccctagc tgacgccatt acctcagtag aatattacct agagcgtctg      1620
     agtgacgacc cggaaaccac cgacgatatc ctccagctgg cccgttccag tgtggaaatt      1680
     ctgggctatc cactgctaga agaacaaaac tttgtcgata gtgatgttaa atccattgaa      1740
     ctagccactt cggacatggg tagcagcgcc ctggaacatg atatggacgc ctggtccggt      1800
     tttactgata aagccgaacc gcaagataac aatagcagca acgatgaggc gcggatcaat      1860
     tccccccagg aaatcacctt accggctgaa ccagaagagg aaccgcaaac acccgctaca      1920
     gcggctaccg aaactcaggc gcaagacgat gatctgattg atgacgaaat cattgagatc      1980
     tttcaggaag aagtaggcga ggtgctggac gcactagacc agtacttccc tcgctgggtc      2040
     gccaacacca gcgatgaaga atccttggta gaattccgcc gcgccttcca cacgctgaaa      2100
     ggatctggcc gcatggtcgg cgccagcacc gtgggcgaac tgggctggtc cgtggaaaat      2160
     atgctcaacc gggttatcga ccgaaccatt gagcccagcg ccgtgctgat tgccctggtg      2220
     caggaagtcc gtaaccgagt acctgcattg gtcgatgctt ttacgctgcg ccaaaccgac      2280
     ccattcgacg tacagccttt aatcgacgcc gccgacaccc tagccaatgg tagccagatc      2340
     aggcaggtcc ccaccttggc cggtgcggct agcaacacca cccacagcaa tgacaacgca      2400
     ggaattctcg acgacatcgt catggacacc accgccgatg ccactcttga cagccctgcg      2460
     gacgctgaat acatcactct agacaacgcc agcgaaaacg agaacctaga actaaccgaa      2520
     ccagcactaa gcgacagcgc taattgcgag cctgccgaca atgacctgtc cactgaggac      2580
     ctggccgcct ttgaagctgc tgccagcgaa gacgccctca atccttggga gacagagagc      2640
     agcagggatg atgtatacct gcttccagcg gacaacgatc ccactggaat cgacgaaggc      2700
     atcagcctgg atttaccaga acaggaaccc gctgacgacg ctgatagcga taccagcaat      2760
     gcatccatag aaagcctatc cgacatcccg gacatgagct gcgccccctt tgaagaggac      2820
     agcaacgaaa gtggcccaga ccccatgttg ctggaaatct tttccagcga agcccgtcgc      2880
     agcctggcac taattgctca atggctggcc aacaacgaca ccgacctgtc cgagcacccg      2940
     gtggatgacg gtgtccaccg tgccctacat actcttatgg gcagcgcgcg gatggccgaa      3000
     atcgaagcag tagccgaagt agccgagcca gcagaaaaac tgacacggga tctgattagc      3060
     agcaaccgcc gggccaacca gcagcagata actctactgg ctaaaaccca tgacttgatt      3120
     ctcgccagcc tggataaaat cacctcgcgc cccccaggtc atctacctgg cgccgacgaa      3180
     ttggtccact ccctgaatca gcaacgcgat caactgcaag atagcagcag caacgatcca      3240
     gacccgcaca ttctttctat tttcctatcc gaaggcatgg atctgatcgt agattcggag      3300
     ccactactaa gccagtgggc acagcacccc gagcacaccg atgaactggt gcacctgcgc      3360
     gatgcattgg aacggcttgc caacagtgct gccacctccg acctcaacga aatccacgat      3420
     ctggcagcag cgctgacggg ctgttacagc gcggtgcaga gcgctcatct ggcttacagc      3480
     gagcgtctat tcaccttagc tagtgaaggc caagaagcgc tgatgaatat gatggactgc      3540
     ctggccgccg gccagaccgt ccacgcgaaa caagaattag tagaggccct gcgtaagctg      3600
     acgggaggcg acgaccctaa cggcagcctg gccgacagca gcagcgacat tacactgggc      3660
     agcacagttg tagtgaccca acgggctgaa cacaccacgg atagtcaccg ctacgaagcc      3720
     cacatggacc cggagctaat ggcgctgttc ctggaagagg ccgaggaaat cctcgagtcc      3780
     gccagccaca gcctcgacca gtgggaggcc ggcgacaaca gcaacatcag cagcctgcag      3840
     cgtgacctgc acaccctgaa aggcggcgcg cgcatggccg gtgtcgctcc ggtggaagac      3900
     ctggcccacg aactggaaaa cctttacgaa agctataacg cggggcaact ggaatcccac      3960
     gcggcgctgt tccacctact gcaccaatgc cacgacagcc tggcaatgat gatcgaaaat      4020
     ctgcaggcca acactccccc tgccgatcat gctgaacata gcgagcaaaa aaacagcttg      4080
     gccaccccac aacccaacac cactggcgcc cccattacga ttgaggacgc acccgcgtcc      4140
     attgatgtgc cccctcaacc gaagcgcgac ccagagttgg tggaaatttt tctggaagaa      4200
     gcggatgaaa ttcttgagtc tgccggcaac agtctggaat tgtggatcag tcaacaggac      4260
     aacctgattg aactgcaatc cctacaacgg gatctgcaca ccctcaaagg gggggctcgc      4320
     atggccgaag tcccggagct gggagaccta ggccatgaac tggaaaccct gtacgaagga      4380
     ctggcccaaa gccaactggc tatcgaaccc agcttatttg atttgcttca ccgctgtcat      4440
     gaccaactgg ctgagatggt ggaggcactg agaaccaacc aaccgctgcc aaatggcggg      4500
     gtactgatcg ccgctatcca cgactatatg gctaaccccg taacctttgc cttgcccgca      4560
     ttatcagcca tacaaacggt acaccccagc cccccctctg ccgacgtggt tgagcaaaac      4620
     cctcccgcga ccagccatga atccgcatca tcaaccccgg cggctgatga tgcatggcaa      4680
     gcggacagcg accctgagat tctgaatatt ttcctggagg agtccgaaga attatcggaa      4740
     atcattaatg cctgcctaac ctcctggagg gataatccgc aaagcacaga cttcaccgac      4800
     gacttaaaac gggcgctaca tacccttaaa ggcggtgcac ggctggccgg gctcaagcaa      4860
     ctgggtgata tcagccacaa ttttgaaaac tatttactgg cgctggagcg tcgtcgtcaa      4920
     accccggcac caagcgattt ccagcccatg ctccgctggc atgatcaaat caaccggggc      4980
     atggagtccg tcgcggcggc ggcacgagcc aatacgcccg ccgcccaggg ggcaaacacc      5040
     accgatcagc ttaatacctt actaaccgcc cctcctcagc cggcccccca gcaaccgcaa      5100
     aaagacgccc gccgtcagcg acaggctcaa gcgcaaccac aggaaatggt tcgagtcggc      5160
     gccgatgttc ttgaagcatt ggtaaaccta gccggggaaa cctctatcaa ccgtggccgg      5220
     gtcgagcagg gcatcactga gtttgccttc aacgtagaag agatgggcaa caccgtacag      5280
     cgcctctacg aacaattacg ccgattggac tcggaaacag aagcgcacat catgtccaac      5340
     tatcagaagg gcgtggatct cggcgaacac gacgaggact tcgatccgct ggaaatggac      5400
     cagtactccg aactgcacca gattgccaag cagctctccg agtccgcctc tgacttgcta      5460
     gacctgaaga acaccctgct ggaccgtaat aaagacacgg aaaccttgct actacagcaa      5520
     gcgcgcatta ataccgagct gcaggaaaag ctgatgcgca cccgcatggt gccattcagc      5580
     cgtttggtgc cacggctgcg ccgtattgtt cgccaaatct ccggtgaagt ggataagcgg      5640
     gtagacttcg atgtgatcaa tccggaaggg gaactggatc gctccctgat ggagcgcgtg      5700
     gtcgccccac tagagcatat gctccgtaat gccgtggatc atggcatcga aaccggtgat      5760
     gctcgcaatg ccgcaggcaa gaaccctact ggacatataa acctcgaact gggccgcgaa      5820
     ggaggagagg ttgtcatcac cctctccgat gatggcaagg gtatcgacac cgatgcggtg      5880
     cgcgagaaag caatagaaca aggcctaatc gccgaagacg cccaactctg cgaacaggaa      5940
     atccaacaat tcatcttcca cgccggtttc tctactgccg ccgcagtaac tcagatctca      6000
     ggccgcggag taggcatgga cgtggtggcc agcgaaatca agcaaatggg gggttcagtc      6060
     gccatcgact cccataaagg gcaaggtaca cgcttcatca ttcggctgcc gttcaccttg      6120
     gccatgaacc gcgccttgat ggtaaaagcc gccgacgatt cctacgcaat cccgttgaat      6180
     cagatcgaag gcatcgtgcg aatcagcccc ttcgaattac agcactactt cgaagaagag      6240
     aacccggtct atacctatgt gggccaagat taccagttac agtatctggg gcactttgtt      6300
     cacggcaacc gtgtaccgca tttggagaat caaaccaccc ccatgccggt actgctaatt      6360
     cgcagtaccg aacataccgt ggctattgtg gtagatgaac tagttggttc ccgggaagtg      6420
     gtggtcaaag ccgtaggccc gcagctagcg accatagccg gcatcagcgg cgccaccatc      6480
     ctcggggatg gttccgtagt catcattctt gatatccatt ccctgattcg tgccgctcat      6540
     gtgcaaacca ctgcccttat ctcggatgag gcggttccgg ccctgcctca agaacccgaa      6600
     gaagaagccc taccccaacg cgaaactccg ctggtcatgg tcactgatga ctcggttacc      6660
     gtgcgcaaag tgaccacccg cttgctggaa cgtaatggct acgaagtggt caccgccaag      6720
     gacggcatgg atgccattgc caagctggaa gatattcgcc cggatgtaat gctgctggat      6780
     atcgaaatgc cccgcatgga cggtttcgaa gtggccagcc atgtgcggca cgacagccgc      6840
     ttacaaaatg tgccaatcat catgatcacc tcccgtaccg gcgagaagca ccgcgaacgg      6900
     gccttcgata ttggcgttaa ctgctacatc ggcaaaccgt tccaagagag cgaactgctt      6960
     tccaccattc gcgagctgct tggtgaactg caggaagtgg ataacggatg a               7011
//

If you have problems or comments...

PBIL Back to PBIL home page