(data stored in ACNUC7421 zone)

EMBL: AM286690.COBS

AM286690.COBS        Location/Qualifiers
FT   CDS_pept        157488..158273
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="ABO_0147"
FT                   /product="Cobalamin 5'-phosphate synthase."
FT                   /function="proposed to catalyze the late steps in
FT                   adenosylcobalamin biosynthesis, which define the nucleotide
FT                   loop assembly pathway."
FT                   /EC_number="6.5.-.-"
FT                   /note="(cobalamin (5-phosphate) synthase) identified by
FT                   sequence similarity; putative InterPro:
FT                   Cobalamin-5-phosphate synthase CobS"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15595"
FT                   /db_xref="GOA:Q0VTC5"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC5"
FT                   /protein_id="CAL15595.1"
FT                   /translation="MKKHQSHHHAQQRFTHRDWQEEWQAFWLAVGFLTRIPMLVRIDYS
FT                   QTLMNRSSVYFPLVGLLLGALYAGLFVLLDAFWATGICVALILVFHLWITGAFHEDGLA
FT                   DSVDALGGGYTVARRLEIMKDSRIGTYGTVALIMALGLKGLLLAEAKTVWLALLLSPVV
FT                   SRLTPLWLMRYLPYVTDPNTSKSKPVAEGFSTQRLCVATALTVVVAALAGAVIPALLSV
FT                   VVVALLWGGYLWRHLRGYTGDTLGASVVLCELVFLLLWG"
     atgaagaagc atcaaagtca tcaccacgcg cagcaaaggt ttacccacag agactggcaa        60
     gaagagtggc aggcgttctg gctggcggtg ggttttctca cccgaatacc gatgctggta       120
     cgtattgatt acagccagac cttaatgaat cgctccagcg tgtattttcc tctggtgggg       180
     ctgttgctgg gcgcgctgta cgcgggctta tttgtattgc tcgatgcttt ctgggccact       240
     ggaatttgtg tggcgctaat attggtgttc cacctgtgga tcaccggggc ttttcatgag       300
     gatgggctgg cggacagcgt ggatgcgcta gggggtggct ataccgtggc ccggcgcctt       360
     gaaatcatga aagatagccg cattggcacc tatgggacgg tggcgctgat catggcgttg       420
     gggttaaagg gcctgttgct ggcggaggcg aaaacggtct ggcttgcctt attgctgagc       480
     ccggtcgtta gccggttaac gccattgtgg ttaatgcgat atttgccgta tgtaacggat       540
     ccaaatacca gtaaaagcaa accggtggca gaagggttta gtacgcagcg gttgtgtgtg       600
     gctaccgcgc tgaccgtggt tgtggcggct ctggcgggtg cggtaattcc tgcgctgtta       660
     tctgttgttg tggtggcgtt gctgtggggt ggatatcttt ggcgacacct acgcggctat       720
     accggtgata cgcttggggc cagcgtggtg ttgtgcgagc tggtgttctt attgctttgg       780
     ggatga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page