(data stored in ACNUC7421 zone)

EMBL: AM286690.DAPB

AM286690.DAPB        Location/Qualifiers
FT   CDS_pept        345007..345834
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ABO_0316"
FT                   /product="dihydrodipicolinate reductase"
FT                   /function="2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) =
FT                   2,3-dihydrodipicolinate + NAD(P)H."
FT                   /EC_number="1.3.1.26"
FT                   /note="identified by sequence similarity; putative
FT                   identified by match to TIGRFAM protein family HMMTIGR00036
FT                   InterPro: Dihydrodipicolinate reductase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15764"
FT                   /db_xref="GOA:Q0VST4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST4"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00036"
FT                   /protein_id="CAL15764.1"
FT                   /translation="MKVGIIGAAGRMGRILIEATLANPDTTLAAAVDVPGSSLIGADAG
FT                   ELVGQGACGVLLVDDLAKVVNEADVFIDFTVPEATVKNLEVCRAAGTRLVIGTTGLDDE
FT                   QKAAVRAAGDDIAICFAPNYSIGVNLCFKLLETAAQIMGDEVDIEVIEAHHRHKIDAPS
FT                   GTALRMGEVVAQTLGRDLSECAVYGREGRTGERERHTIGFETIRAGDIVGDHTVMFAAE
FT                   GERVEITHKASSRMSFGRGAVRAAAWLGRHDKGLFDMQDVLGLAGESAGWGKA"
     atgaaagtag gtattatcgg tgcggcgggt cgcatggggc gtattctgat tgaggcgacg        60
     ctggctaacc cggataccac gctggcggcg gcggtggatg tccctggttc cagtttgatc       120
     ggcgcggatg ccggtgagtt ggtggggcaa ggagcctgtg gtgtgttgct ggtggacgat       180
     ttggccaagg tggtaaatga ggcagatgtg ttcatcgact tcactgtgcc ggaagccacg       240
     gtgaagaatc ttgaggtgtg ccgcgcggcg ggcacgcggt tggtgatcgg cactaccggt       300
     ttggatgatg agcagaaagc ggccgtgcgt gccgccggtg atgatatcgc tatctgtttt       360
     gcgcccaatt actccattgg ggtgaacttg tgcttcaaat tgctggaaac ggcggcgcag       420
     attatgggcg atgaggtgga tatcgaagtg attgaggccc accatcggca taaaatcgat       480
     gcgccgtctg gtacggcgtt gcgcatgggt gaggtggtgg ctcagacctt ggggcgcgat       540
     ctgagcgagt gtgcggtgta cggtcgtgaa ggccgcaccg gcgagcgcga gcgccatacc       600
     attggttttg agacgattcg ggccggcgat attgtcggcg accacactgt gatgtttgcc       660
     gcagagggtg agcgggtgga aattacccac aaggcctcca gtcgtatgtc gttcggtcgc       720
     ggtgctgtgc gtgcggctgc ttggttgggc cgtcacgaca aggggttgtt cgacatgcag       780
     gatgtgcttg gtctggctgg tgaaagcgcc ggttggggca aggcctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page