(data stored in ACNUC7421 zone)

EMBL: AM286690.DKSA

AM286690.DKSA        Location/Qualifiers
FT   CDS_pept        complement(381076..382053)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ABO_0345"
FT                   /function="DnaK suppressor protein"
FT                   /note="(C4-type zinc finger protein DksA/TraR family)
FT                   identified by match to PFAM protein family HMMPF01258"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15793"
FT                   /db_xref="GOA:Q0VSQ5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ5"
FT                   /inference="protein motif:HMMPFAM:HMMPF01258"
FT                   /protein_id="CAL15793.1"
FT                   /translation="MATGKKKASSKAAKKQTPDSASSSKNPPASVKTANKKTPAKKVAA
FT                   KKATAKKATAKAATKPAAKKAAAKKPSTTKTASKAVATSKKATTTSPVKAPAAKRQAKA
FT                   KPASKAAAKKASTNKTTLATPRTKLPASGKATAAARSAAAKATAHAGSARTAAAGKKTS
FT                   PSRSPSSAQVNSKVKKKTSSSSASQAQVHGFTPYQPGPDEEYMNEKQREHFRNILLAWR
FT                   QELMEEADRTMHHLQDEQANLPDPADRATQEEEFALELRTRDRERKLLKKIEKTLDLVD
FT                   KDDYGFCEACGVEIGIRRLEARPTAELCIDCKELAEIKERQVAG"
     atggccaccg gcaagaaaaa agcttcctca aaggcggcta aaaaacaaac ccccgactct        60
     gcttccagca gcaagaaccc ccctgcatcg gtaaaaacgg caaataagaa gaccccagcc       120
     aaaaaagtgg ctgcgaagaa ggcgactgca aaaaaggcaa ccgctaaagc cgcaaccaag       180
     cccgctgcaa aaaaagccgc tgcgaagaaa ccttccacca caaaaacggc gagtaaggca       240
     gtcgcaactt ctaagaaagc cacgactacc tcacccgtaa aagccccggc agccaaacgc       300
     caggccaagg ccaaaccggc ctccaaggcc gccgcaaaaa aggcctccac caacaagaca       360
     accctcgcga caccgagaac aaaattaccc gcatcaggca aggctaccgc agccgctcga       420
     tctgctgctg cgaaagccac cgcacacgcg ggttctgcac gaacagcagc tgccggcaaa       480
     aagacttcgc cgagccgctc cccctcttct gctcaggtaa attcgaaagt gaaaaagaaa       540
     acctctagtt cctctgcatc acaggcccag gttcacggct tcacgcctta ccaacccggc       600
     cctgatgagg aatatatgaa tgaaaagcaa cgcgaacact tccgcaacat cttgctggcc       660
     tggcgccagg aactaatgga ggaagcggac cgcaccatgc atcatctgca ggacgagcaa       720
     gccaacctgc ccgacccggc cgatcgcgcc acgcaggaag aagaatttgc cctggaactg       780
     cgcacccgtg accgcgaacg aaaactgctt aagaaaatcg agaagaccct cgatctggtt       840
     gacaaggacg actatggctt ctgtgaagca tgtggcgtag aaatcggtat tcgccgcttg       900
     gaagctcgcc ccaccgcaga gttgtgtatc gattgcaaag aactggccga aatcaaagaa       960
     cggcaagtgg cgggataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page