(data stored in ACNUC7421 zone)

EMBL: AM286690.DNAA

AM286690.DNAA        Location/Qualifiers
FT   CDS_pept        1..1425
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ABO_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF03969 and KEGG dnaA in multiple genomes. InterPro:
FT                   Bacterial chromosomal replication initiator protein DnaA"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15449"
FT                   /db_xref="GOA:Q0VT30"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT30"
FT                   /inference="protein motif:HMMPFAM:HMMPF03969"
FT                   /protein_id="CAL15449.1"
FT                   /translation="MSEELWQRCLTRLEDELPSQQFNMWIRPLQVAASADGAELTLFAP
FT                   NRFVVDWVRDKYLDRISEVLGEMQSGPLPQLRLEVGSTRASTPAASYFNGSSSSSSNGP
FT                   ITTPAAAPAPRQPESDSRPQPTSLGGARKHRSNLNTGFTFSTFVEGKSNRMAAAAAQQV
FT                   AENPASHGYNPLLLYGGVGLGKTHLMHAVGNELLRRNPNAKVVYLHSERFVADMISALR
FT                   NKTINEFKRFYRSVDALLIDDIQFFAGKEQSQEEFFHTFNALLENGQQIILTCDKFPKE
FT                   VDGLEERLKSRFGWGLSQPMEPPELETRVAILKKKAEEAKVDLPNDAAFFIAQRIRSNV
FT                   RELEGALRRVIAHVRFTGAQIDIGLIKEALKDLIALQARQISIDNIQRIVAEYYKIKIN
FT                   DLLSPRRTRSVARPRQVAMALSKELTSHSLPEIGENFGGRDHTTVLHACRKVLELRESN
FT                   PEIEEDYLNLLRTLTS"
     gtgtctgaag agctctggca acgctgtttg acgcggctgg aagatgagtt gccgtcgcag        60
     cagttcaata tgtggatacg gccgcttcaa gttgctgcgt ctgcagatgg tgcggagcta       120
     acattgtttg cccctaaccg gtttgtggtg gattgggttc gtgacaagta cctagatcgc       180
     attagcgagg ttctagggga gatgcagtca ggcccccttc cccaattgcg tttggaggta       240
     gggtctaccc gtgccagcac gcctgcagca tcgtacttca atggttcctc ctcctcctct       300
     agtaatgggc cgataacgac gcctgccgcg gctccagcgc cccgtcagcc tgagtctgat       360
     agccgaccgc aacccacttc gttgggtgga gctcgtaagc accgcagcaa ccttaataca       420
     ggctttactt tctcaacctt cgttgagggt aaatccaatc gtatggcagc ggcggcagcg       480
     cagcaggtag ccgaaaaccc ggccagtcat ggctataacc ctttgctttt gtatggtggt       540
     gtggggctgg gtaaaactca cctgatgcat gcggtcggca atgagttgtt gcgacgcaac       600
     cccaatgcca aggtggtcta tctgcacagt gaacggtttg tagcagatat gatttctgcc       660
     ttacgtaaca agaccattaa cgagtttaag cggttttatc gttctgtgga tgctctgctg       720
     attgatgata ttcaattttt tgcaggaaaa gagcagtccc aggaggagtt ttttcacacc       780
     ttcaatgcgt tactggaaaa tgggcaacag atcattctca cctgcgacaa gtttcctaaa       840
     gaggtggatg gcctagagga gcgtctgaag agccgttttg gttgggggtt gtctcagccg       900
     atggagccgc cggaattgga aacgcgagtg gcgattctta agaaaaaagc cgaagaagcc       960
     aaggtggatc tgccgaatga tgcggccttc tttattgccc agcggattcg ttcaaacgtg      1020
     cgggagctag aaggcgcatt gcgtcgggtg attgctcacg ttcgctttac cggtgcgcag      1080
     attgatatcg gcctgatcaa ggaagcgctg aaggatttga ttgcactgca ggcgcgacag      1140
     atcagtattg ataatattca gcgcatcgta gccgaatact acaaaattaa gattaatgat      1200
     cttttgtctc cacgacgcac acgttccgtg gcgcggcccc ggcaagttgc tatggcgttg      1260
     tcgaaagagt tgaccagcca cagcttgccg gaaattggtg agaattttgg tggccgggat      1320
     cacactacgg tactgcacgc ctgtcgcaaa gtactggagt tgcgggaatc caatccggaa      1380
     attgaagaag attatctgaa tctgttacgg acattgacgt cctaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page