(data stored in ACNUC7421 zone)

EMBL: AM286690.DNAN

AM286690.DNAN        Location/Qualifiers
FT   CDS_pept        1478..2578
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ABO_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by sequence similarity"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15450"
FT                   /db_xref="GOA:Q0VT29"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT29"
FT                   /protein_id="CAL15450.1"
FT                   /translation="MKFSINREQLLKPLQQVAAVVEKRQTLPVLSNVLLEVGDGQLSMT
FT                   GTDLELELVARLPLEGELEPGETTVPARKLVDIGKSLPAEADIRFEVDGERMLVRSGRS
FT                   RFTLSTLPASEFPNLEEDAAGSSLEIKPDVLRGLIDRTAFSMAQQDVRYYLNGMLFELK
FT                   SGRLRAVATDGHRLALCDAELDVPVEEASVILPRKGVMELSRILGDSGEVARLTIGRNH
FT                   VRIVVGAITFTSKLVDGKFPEYDRVIPKEGSRKVVADRETLRQALARVAILSNEKYRGV
FT                   RVQLSEGSLRIVANNPEQEEAEEEVSVDFNGSPLEIGFNVSYLLDVLNTMGGTQAELEM
FT                   GDSNSSALVFDPESKAAVYVVMPMRL"
     atgaaattct caatcaatag agaacagctg ctcaagccgc tacagcaggt tgcggcagtg        60
     gtggagaagc ggcagacctt gccggtactg tccaatgtgt tattggaagt gggtgatggc       120
     cagctatcta tgaccgggac agacctggaa ctggagctgg tcgcccgttt gccgcttgag       180
     ggcgagcttg agcctggcga aaccaccgtg ccggcccgta agctggtaga cattggcaag       240
     agcttgccgg cggaggcgga tatccgtttt gaggtggatg gtgagcgcat gctggttcgt       300
     tctggccgta gccgctttac tctgtccacc ctgccggcct ccgaattccc gaatctggaa       360
     gaagatgccg ctggcagtag ccttgagatt aagccggatg tgttgcgtgg tctgattgat       420
     cgaacagcgt tttctatggc tcagcaggat gtgcgctatt acctgaacgg gatgcttttt       480
     gaacttaagt ctggccgttt gcgtgcggtg gctaccgatg gccaccgcct ggccctgtgc       540
     gatgcagaac tggatgtacc cgtggaagag gcgtcggtta ttctgccgcg caaaggggtg       600
     atggaactat cgagaatcct cggggatagc ggtgaagttg cacgcctgac tattggtcgt       660
     aatcatgtgc gtatcgtggt cggagcgatc actttcacgt ccaagttagt tgatggtaag       720
     tttccggaat atgaccgagt aatcccgaag gaaggatccc gtaaggtggt ggctgaccgt       780
     gagaccctgc gccaagcgtt ggctcgggtg gcgatccttt ctaacgaaaa gtaccgtggt       840
     gtgcgggtgc agttgtctga gggtagtttg cggattgtgg ctaacaaccc agagcaggaa       900
     gaagcggaag aagaagtgtc cgtagatttt aatggctcgc ccttggagat tggtttcaat       960
     gtcagctatc tgttggacgt gctgaatact atgggtggca cgcaggcgga attggagatg      1020
     ggtgatagca atagcagtgc cctggttttt gatcctgaga gtaaggcagc cgtgtatgtg      1080
     gttatgccga tgcgcctctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page