(data stored in ACNUC7421 zone)

EMBL: AM286690.ESTA

AM286690.ESTA        Location/Qualifiers
FT   CDS_pept        43290..44318
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="ABO_0043"
FT                   /product="lipase/esterase"
FT                   /function="hydrolysis of water- soluble or insoluble
FT                   esters, including triglycerides"
FT                   /EC_number="3.1.1.-"
FT                   /note="(lipase/esterase family protein) identified by
FT                   sequence similarity; putative InterPro:
FT                   Esterase/lipase/thioesterase/carboxlesterase family active
FT                   site"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15491"
FT                   /db_xref="GOA:Q0VTL7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL7"
FT                   /protein_id="CAL15491.1"
FT                   /translation="MNPAVIERATVRALMSLPGPVLERLAAGLETHSRPHLDSRLRFLL
FT                   ALSGAKPTLDSGTVEQARQIYRSTLALLDMAPVSLPVVVDHQVSMEDGSQILVRRYRPA
FT                   DAPLVSPAIMFFHGGGFTIGGVEEYDRLCRYIAKRTNAVVLSVDYRLAPEHPAPAGMDD
FT                   ALEAWRWLLNNTAQLGLDPNRLAVMGDSAGGCMSAVVSQQAKLAGLALPALQVLIYPTT
FT                   DAALAHPSVQTLGQGFGLDIPLLTWFRGHFVQDPAVIEDYRVSPLRNPDLTGLPEAIVI
FT                   TATDPLRDEGLEYAQKLREAGNTVTSLDYPELIHGFISMGGVVPAARKAINDICVETKR
FT                   RL"
     atgaatcctg ccgttattga gcgggccacg gtacgtgccc tgatgtcttt gccgggcccg        60
     gttttggagc gtttggctgc gggtttggaa acccatagtc gtccgcattt ggattcgcgt       120
     ctgcgctttc tgcttgcgct cagtggggcc aagcccaccc tggattcagg gacggtggag       180
     caggctcggc agatttatcg gagcacgctg gcattgctag atatggcacc ggttagcctt       240
     cctgtggttg ttgatcatca ggttagcatg gaggacggta gccaaattct agtgcggcgt       300
     tatcgcccgg ccgatgctcc gctggtgtca ccggctatta tgttttttca cggtggagga       360
     ttcactattg gcggtgttga agagtatgac cggttgtgtc gctatatagc gaagcgtacc       420
     aatgcggtgg tgctgagtgt ggattaccgg ttggcgccgg aacacccagc ccctgccggc       480
     atggatgatg cgttggaggc ttggcgctgg ttgctgaata acaccgcgca gctggggctt       540
     gatccgaacc gcttggcggt gatgggcgat agcgctggcg gctgcatgag cgcagtggtg       600
     tcacaacagg ccaagctggc cggcctggcg ttgccagctt tacaggtgct gatctacccc       660
     accactgacg ccgccctggc ccacccttcc gtgcaaacgt tggggcaagg gttcggcttg       720
     gatataccgc tgctgacttg gttccgagga cactttgttc aagacccagc ggtgatcgag       780
     gactaccgcg tttcgcccct gcgcaaccct gatttaactg gcctgcctga ggcgatcgtt       840
     atcacggcta cggatccctt gcgggacgaa ggcttggagt acgcccaaaa attacgtgag       900
     gcaggaaaca cggtgacctc actggattat cccgaactga tacacggctt tatttccatg       960
     gggggtgttg ttccggcggc gcgtaaggca atcaatgaca tttgcgttga gaccaagcgg      1020
     cggttgtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page