(data stored in ACNUC7421 zone)

EMBL: AM286690.FADA1

AM286690.FADA1       Location/Qualifiers
FT   CDS_pept        271972..273138
FT                   /transl_table=11
FT                   /gene="fadA1"
FT                   /locus_tag="ABO_0253"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /function="Formation of acetoacetyl-CoA from two molecules
FT                   of acetyl-CoA."
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by sequence similarity;"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15701"
FT                   /db_xref="GOA:Q0VSZ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSZ7"
FT                   /protein_id="CAL15701.1"
FT                   /translation="MAEAYIVAAVRTAGGKKNGRLSKVHPADMGGRVIDAVVERTGVAP
FT                   EKVDDVIFGCVSQIGPQAFNVARTSIMSSCLPESVPGVTIDRQCGSSQQAIHFAAQAVM
FT                   SGTQDLVIAGGVESMSQLPIGSPVLAAKELGNPFTGEISKRYPSATFSQFHGAERMAEK
FT                   YGVSKAELDQFAYDSHKRGAAATQAGRFSDEIIPVPVTLEDGSQEDHVVDEGIRWEAEL
FT                   DAIKALEPLQEGGHISAANASQITDGASAVMIASEAAVKELGLTPLARIHAMAVVGSDP
FT                   TMVLEGPIPATEKVLKQAGMSMADIDLYEVNEAFGSVPLAWMKAVGADYEKMNVNGGAQ
FT                   ALGHPLGATGSKLMGTLVYELKRRGGKYGLLTICEGLGTANATIIEAL"
     gtggcagaag catatatcgt agcggcggtg cgtaccgcgg gtggtaaaaa gaacggtcgg        60
     ttgagcaagg tacacccggc ggacatgggt ggccgtgtta ttgatgcagt ggtagagcgc       120
     acgggtgtgg ctccagagaa agtcgacgac gtgatttttg gttgcgtgag ccagattggc       180
     ccacaggcct ttaacgtggc gcgcacttcc attatgagct cctgcctacc ggaatctgtg       240
     ccgggggtta cgattgaccg ccagtgtggg tcttcccagc aggccatcca ctttgcagcc       300
     caagcagtga tgagtggcac tcaggatttg gtaattgcgg gtggtgtgga atccatgagc       360
     cagctgccga tcggttcccc ggtgcttgcg gcgaaagaac tgggcaaccc gtttaccggt       420
     gaaatcagca agcgatatcc cagtgcaaca ttcagccaat tccatggggc tgagcgtatg       480
     gcggaaaaat acggagtgag caaggcagag ctagaccagt tcgcctatga ctcccacaag       540
     cgtggtgctg cagcgacgca agcgggtcgt ttcagcgatg agatcatccc ggtaccggtg       600
     accctggaag acggctctca ggaagaccat gtggtcgatg aagggattcg ctgggaagca       660
     gagctggacg cgatcaaagc gctagaacct ctgcaggaag ggggacatat cagtgccgcc       720
     aacgcgagcc agataacgga cggggcttcc gccgttatga tcgccagcga ggctgcggtt       780
     aaagaactgg gtttgacacc gctggcgcgt attcatgcca tggcggtggt gggctctgac       840
     ccgaccatgg tattggaagg cccgatcccg gccactgaga aagtgcttaa gcaggccggc       900
     atgagtatgg cggatattga tctgtatgaa gtgaacgaag cgttcggctc ggtgccattg       960
     gcctggatga aggcggtggg tgcggattac gaaaaaatga acgtgaacgg tggtgctcag      1020
     gcgttaggcc acccattggg ggccaccggc tccaagttga tgggtacgtt ggtctatgag      1080
     ctcaagcgcc gtggtggcaa gtacggcctg ctgactatct gtgaaggctt agggacggca      1140
     aacgctacca ttattgaagc gttatag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page