(data stored in ACNUC7421 zone)

EMBL: AM286690.FADB

AM286690.FADB        Location/Qualifiers
FT   CDS_pept        193760..195310
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="ABO_0184"
FT                   /product="long-chain-fatty-acid-CoA ligase, putative"
FT                   /function="Synthesis of Acyl-CoA"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR01734"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15632"
FT                   /db_xref="GOA:Q0VT88"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT88"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01734"
FT                   /protein_id="CAL15632.1"
FT                   /translation="MYITQTLRRAVQLNGEGTATIFAGRRQTWKKFEDRIARLANGLVG
FT                   LGVESGDRVAILSLNSDRYMEYFYAVPWAGAAVNPINIRLAPPEIAFTLNDSGSKILFI
FT                   DDTFSALLPILRPQFESIKHVVFIGDGECPEGCIDYESLIVQSERMSDVDAGGDDLAGL
FT                   FYTGGTTGRSKGVMLSHDNLVFNALNVVAEMGYGRDTVYMHAAPMFHLADMASTFAVTL
FT                   AAGTHGIVPRFDVDEVLAFIEREKITDALLVPTMVNLLASSGRIANYDVSSIRRMLYGA
FT                   SPMPEAVLISAMEQMPKASFAQGYGQTEASPIITTLAPEFHVAGGEKLRSAGRAALGVE
FT                   VMVVNENDEEVPRGTVGEICVRGGNVMRGYWGMESTTEETLRNGWLHTGDLAYMDEDGF
FT                   VFIVDRAKDMVISGGENIFSVEVEGAIYSHSAVQECAVIGIPDEKWGESVHAIVVLCEG
FT                   SSASETDIIDHCREKIAGYKVPRSIEFRSEPLPISGAGKVLKNELRSPYWEDKSMRVN"
     atgtatatca cacagacctt gcgtcgtgct gttcagttaa atggagaagg tacggccact        60
     atttttgctg gccggagaca aacctggaag aagtttgagg atcgtatcgc acgccttgca       120
     aatggtctgg tagggctggg ggttgagtcg ggcgataggg ttgcgatcct atcgctgaac       180
     agtgaccgct atatggagta tttttatgcg gttccctggg cgggagctgc ggtaaaccct       240
     atcaatattc gtctcgcacc gccggaaatt gcatttacgt taaatgattc aggttcgaaa       300
     attctattca ttgatgacac cttttcagcg ttgcttccga tactccgacc acagtttgaa       360
     tcaataaagc atgtggtttt tattggtgat ggtgagtgtc cggaaggttg tattgattat       420
     gaatcgctta ttgttcaatc cgagcgaatg agcgatgtag acgcgggcgg agatgacctt       480
     gctggccttt tttataccgg cggtactacg gggcgctcga aaggggtaat gcttagtcac       540
     gacaacctag tattcaacgc actgaatgtc gtcgcagaaa tggggtatgg gcgtgacact       600
     gtctatatgc atgctgctcc aatgttccat ctggctgaca tggccagcac ttttgctgta       660
     acccttgcag caggaaccca tggaattgtt cctcgttttg atgttgatga agttttggcg       720
     ttcatagaac gcgagaaaat cacagacgcc ttgcttgtgc caaccatggt taatcttctt       780
     gcctcatctg ggcgtattgc taattacgat gtaagcagca taaggcgaat gctttatgga       840
     gcctcaccga tgccagaagc ggtgttgata agcgcgatgg agcaaatgcc gaaagcctcg       900
     ttcgcccagg gctatggcca gactgaagct tcaccaatca ttaccacgct tgctcctgag       960
     tttcatgttg ctggtggcga aaagttacgg agcgcagggc gtgcggcctt gggtgttgag      1020
     gtaatggttg taaatgaaaa cgatgaagaa gtacctcgtg gcacagttgg tgaaatctgt      1080
     gtgcgtggtg gcaatgtcat gcgtggttac tggggtatgg agtccaccac ggaagaaact      1140
     ctgcgcaacg gatggttgca tacaggggat cttgcttaca tggatgagga tggtttcgtt      1200
     ttcattgttg atcgcgccaa agatatggtt attagtggcg gtgagaacat tttctcggtt      1260
     gaggtcgaag gcgctatata tagtcattcg gcagtacaag aatgcgcagt gatcggaatc      1320
     cctgacgaaa aatggggaga atctgttcat gcgatagtgg tgttatgcga aggaagtagt      1380
     gccagtgaga cagatatcat tgatcactgt agagaaaaaa tagctggcta taaggtgcct      1440
     cgttcgattg agtttcggag tgagccgtta cccatcagtg gggcaggaaa agtattaaaa      1500
     aatgaacttc gatcccctta ctgggaagat aagagtatgc gggttaactg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page