(data stored in ACNUC7421 zone)

EMBL: AM286690.FIMA

AM286690.FIMA        Location/Qualifiers
FT   CDS_pept        complement(135969..136514)
FT                   /transl_table=11
FT                   /gene="fimA"
FT                   /locus_tag="ABO_0126"
FT                   /product="Type-1 fimbrial protein, A chain precursor"
FT                   /function="required for pilus biogenesis."
FT                   /note="(Type-1 fimbrial protein, A chain precursor)
FT                   identified by match to PFAM protein family HMMPF03797 and
FT                   sequence similarity"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15574"
FT                   /db_xref="GOA:Q0VTG9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG9"
FT                   /inference="protein motif:HMMPFAM:HMMPF03797"
FT                   /protein_id="CAL15574.1"
FT                   /translation="MNNFTRIISIAAISGISSIAIANTGEVIFNGVVSDTTCTLDVSQQ
FT                   GIAQADNTVTLDPITTAEFLASDTAYKATGFSLVATDAGSATCNLTGKGASVQWTGQLY
FT                   VGHNILQNIATGGAANVGMQLLESDGTTPVTVNGSPSIIADASGASLDFNVGYAATDAT
FT                   AVTEGQVRSIANYSIVFN"
     atgaacaatt tcactcgcat catatccatc gccgctatca gcggcatcag ctcaatcgcc        60
     atagccaaca ccggtgaagt aattttcaac ggggtggtca gcgacacaac gtgcacgttg       120
     gatgtctccc aacaagggat cgcccaagca gataacaccg tcactctgga tccaattact       180
     accgccgagt tcctagcttc agataccgcc tacaaggcaa ccggattctc ccttgttgct       240
     accgatgcag gctctgcgac atgtaatctg accggcaaag gcgcctccgt acagtggaca       300
     ggtcaacttt atgtcggtca taacatcctg caaaacatcg ctactggcgg tgctgccaat       360
     gttggcatgc agctgcttga atctgatggc acaacaccag taaccgttaa tggctctcca       420
     tcgatcattg ccgatgcttc aggtgcgagt cttgacttca atgtaggcta tgccgccact       480
     gacgctaccg cagtaacaga aggtcaggtt cgctccatcg ccaactactc aattgttttt       540
     aactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page