(data stored in ACNUC7421 zone)

EMBL: AM286690.FIMC

AM286690.FIMC        Location/Qualifiers
FT   CDS_pept        complement(132741..133475)
FT                   /transl_table=11
FT                   /gene="fimC"
FT                   /locus_tag="ABO_0124"
FT                   /product="type 1 pili chaperone protein FimC"
FT                   /function="P pilus assembly protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF02753 and sequence similarity"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15572"
FT                   /db_xref="GOA:Q0VTH1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTH1"
FT                   /inference="protein motif:HMMPFAM:HMMPF02753"
FT                   /protein_id="CAL15572.1"
FT                   /translation="MCYQRRQLMKKTFIFIVVIFIFISSHAQAAFVLGGTRVVYNAGDN
FT                   DVTLSVMNTSSLPYAGQAWTDPFHQEAGNSIHSDAPNFVITPPVFRVEPGETQKLRFIL
FT                   ATPPPSEEVESVYWINVQEIPPEPKNSNTLQFAQRIRIKLFYRPDALNELSASEAPTSL
FT                   KISLTEEGVSIKNPAPFSVSFFSPLLEDKTGKKHPLDELLTLLPGEEFIVKCQPCGYTR
FT                   FHFQSINDFGGIDDHEPREISP"
     atgtgttacc agcggagaca attaatgaaa aagacattta tttttatcgt cgttatcttt        60
     atttttatca gcagccacgc tcaagccgct ttcgtgcttg gcggtacgcg agtggtctac       120
     aacgcaggcg acaatgacgt caccctctct gttatgaata ccagctcgct gccctatgct       180
     gggcaagcat ggactgatcc tttccatcag gaagcaggaa attcgatcca cagcgacgcg       240
     ccgaattttg ttattacccc tccggtgttt cgagtagagc caggagaaac ccaaaaacta       300
     cgttttatcc tggccacgcc ccctccaagc gaagaggtgg agtcagttta ttggatcaat       360
     gttcaggaga ttccaccgga gcctaaaaat tccaacacgc tacaatttgc tcaacgtatt       420
     cggatcaagc ttttttatcg gcctgacgca ctaaatgaat tatccgcctc ggaggccccg       480
     acatccttga aaatcagcct caccgaggaa ggggtgagca ttaaaaaccc ggcccccttt       540
     tctgtttctt ttttttctcc tctactggaa gacaagacgg gaaaaaaaca tcctctagac       600
     gaattattaa ccttgctacc tggcgaggaa ttcattgtta agtgccaacc ctgtggttac       660
     acccgattcc atttccaaag tatcaatgat ttcggtggca ttgatgacca tgagccgagg       720
     gagatctcac catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page