(data stored in ACNUC7421 zone)

EMBL: AM286690.FOLP

AM286690.FOLP        Location/Qualifiers
FT   CDS_pept        354212..355075
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="ABO_0323"
FT                   /product="dihydropteroate synthase"
FT                   /function="2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropt
FT                   eridine diphosphate + 4-aminobenzoate = diphosphate +
FT                   dihydropteroate"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Dihydropteroate synthase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15771"
FT                   /db_xref="GOA:Q0VSS7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSS7"
FT                   /protein_id="CAL15771.1"
FT                   /translation="MHQKTLSCGARTLNLSAPVVMGVLNVTPDSFSDGGRFTERDAALR
FT                   QAEQMLRDGAAIIDVGGESTRPGASPVSEQYELDRVVPIVEALSYELNALVSVDTSTAA
FT                   VMRASAAAGAGMINDVRSLRRPGAIQAAAASQLPVCLMHMRGEPGNMQDNPRYDDVTAE
FT                   VVALLRERIGACERAGISRERLLVDPGFGFAKTVQHNLQLMHEMDALQTLALPILIGVS
FT                   RKSLFGKVLGRDVNERLPGSLAAAVMCVERGASIVRAHDVKETVDVVRFAHAVMESQRE
FT                   SQKELS"
     atgcatcaaa agacacttag ctgtggggcg cggacactga acctgtccgc gcctgtcgtt        60
     atgggggtcc ttaatgtgac ccccgactcc ttttccgatg gtggccggtt taccgagcgc       120
     gatgccgcgc tgcgtcaggc agagcagatg ttgcgtgacg gagcggcgat tattgatgtg       180
     gggggagagt ctacccggcc tggtgcttcg ccggtgtctg agcaatatga gcttgaccgg       240
     gttgtcccta ttgttgaggc gctaagctat gagctgaatg cgctagtgtc tgtggatacc       300
     agcaccgcgg cagtgatgcg cgcgagtgcg gcggctggcg caggcatgat taatgatgtc       360
     cgctctttgc gtcgccccgg tgccattcag gcagcagcgg ccagtcagct cccggtctgt       420
     ttgatgcata tgcggggtga gcccggcaac atgcaagata acccccgtta cgatgatgtt       480
     actgccgagg tggtcgcctt gctccgtgag cgtatcggcg cgtgtgagcg ggcaggtatt       540
     tcgcgggagc gcctgttggt ggatccgggg ttcggatttg ccaagacggt acagcacaat       600
     ttgcagctga tgcatgagat ggatgcgctt cagactctgg cgttgcctat tctgattggg       660
     gtgtcgcgga aatctttatt tggcaaagtg ttggggcgcg atgtgaacga acgattgcca       720
     ggcagcctag cggcggccgt aatgtgcgtg gagcgcggtg ccagcattgt gcgcgctcac       780
     gatgttaaag aaaccgtgga cgtggtgcgt ttcgcccatg cggttatgga atcacaaaga       840
     gaatcgcaaa aggagttgtc atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page