(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSA

AM286690.FTSA        Location/Qualifiers
FT   CDS_pept        660170..661405
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ABO_0602"
FT                   /product="cell division protein FtsA"
FT                   /function="this protein may be involved in anomalous
FT                   filament growth (by similarity). may be a component of the
FT                   septum. it may interact with ftsz."
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Cell division protein FtsA"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16050"
FT                   /db_xref="GOA:Q0VRZ8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VRZ8"
FT                   /protein_id="CAL16050.1"
FT                   /translation="MATATENMIVGLDIGTSKVVAIVGQTAADGTLEIVGLGSQPSRGM
FT                   KKGVVVDIEATVRSIQRAVEEAELMAGCHIHTVYAGIAGSHVRSLNSHGIVAIRDREVA
FT                   QADIDRVIDAAQAVAIPADQKTLHVLPQEYVVDNQEGVREPIGMSGVRLEAKVHLVTCA
FT                   VNAVQNIEKCVRRCNLEVDDVILEQLASAHAVLTEDERELGVCIVDIGGGTTDIAIFTE
FT                   GAIRHTANIPIAGDQVTNDIAMALRTPKQHADEIKIKYACALTQLAGADETIKVPSVGD
FT                   RPPRTLSRQNLAEVVEPRYDELFTLVQAEIRRSGFEDLIPGGIVLTGGSSKIEGAVDLA
FT                   EEIFHMPVRLGAPQGISGLIDVVKNPIYSTSVGLLLYGQRMEKEGTSAKAQAGGGELDW
FT                   LERIKSWFKGNF"
     atggcgactg caacagaaaa catgattgtc ggacttgata ttggcacctc aaaggtagtt        60
     gccatcgtcg gccagacagc agccgatggc accttggaaa tcgtcggtct gggctcgcaa       120
     ccgtcacggg gcatgaaaaa gggcgtggtg gtggatatcg aagccaccgt gcgctcgatt       180
     cagcgtgcgg tggaagaagc cgagctaatg gcgggttgtc atattcacac ggtgtacgcc       240
     ggtattgccg gttcccatgt gcgtagcctc aattcccacg gcattgttgc cattcgcgac       300
     agggaagtgg cccaggcaga tattgaccgg gtgatcgacg cggcccaagc ggtggcgatt       360
     ccggcggacc agaaaacctt gcatgtgctg ccacaggaat atgtggtgga caaccaggaa       420
     ggtgtgcgcg agcccatcgg tatgagcggc gtgcgcttgg aagccaaagt gcatttggtg       480
     acctgtgcgg tgaatgcggt gcaaaacatc gagaaatgtg tgcgtcgctg caacttggaa       540
     gtcgatgacg tcatccttga gcagttagcg agtgctcacg ccgtgctcac cgaagatgag       600
     cgcgaactgg gtgtctgcat cgtggatatt ggcggcggca ccacggatat cgccatcttc       660
     accgaaggcg ccattcgtca taccgccaat attcccattg ctggggacca ggtgactaac       720
     gatatcgcta tggcgttgcg cacccccaaa cagcatgccg acgaaatcaa aatcaagtac       780
     gcctgtgcgt tgactcaact ggctggcgca gatgaaacca tcaaggtgcc cagcgtgggt       840
     gatcgtccgc cgcgcaccct tagccgtcag aatctggctg aggtggtgga gccacgttac       900
     gacgaattgt tcaccttagt gcaggcggaa attcgtcgct ccggatttga agatttgatc       960
     cctggcggga ttgtgctcac cggtggctct tcgaagattg aaggggcagt ggatttggct      1020
     gaggagattt ttcatatgcc ggttcgccta ggtgcgccgc agggtatttc tgggctgatt      1080
     gatgtggtga aaaacccaat ttactccacc tctgtgggcc tgctgttgta cggccagcgc      1140
     atggagaagg aaggcactag cgccaaggcc caagccggtg gtggtgagct ggactggctg      1200
     gaacgtatta agagctggtt caaaggtaat ttttag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page