(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSI

AM286690.FTSI        Location/Qualifiers
FT   CDS_pept        647862..649583
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ABO_0592"
FT                   /product="penicillin-binding protein 3"
FT                   /function="responsible for the final stages of
FT                   peptidoglycan biosynthesis for cell wall formation"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Penicillin binding protein transpeptidase domain"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16040"
FT                   /db_xref="GOA:Q0VS08"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS08"
FT                   /protein_id="CAL16040.1"
FT                   /translation="MKKQARKIRQPNHLMRWRFVLGFWSVCACLLLIRAVDLQVIQHDF
FT                   LAHQGDIRNLRVEPLAAHRGVIRDRAGKPLAVSTPVVTLWVNPREAMEHQDQWGRLAGN
FT                   SVIDQKAFARKVRRHKSREFIYLERGLAPETAKTVLSLNVPGVYALTEYRRYYPAGEVA
FT                   SHVVGFTNIDDQGQEGIELALEDHLSGHSGRKKVVRDLLGRVIQDIEVLEPAEPGEDVT
FT                   LSIDLRLQYLAYRELLGAVQKFNAKGGSAVVLDVRTGEVLAMVNQPAYNPNNRGNLDTG
FT                   ALRNRAVTDLFEPGSTMKPFTVAAALEMGMVTPSTTINTHPGTLRVGSKTIRDHRDYGV
FT                   IDITTVLTKSSNVGTSKLALAMDSQALPGYLERFGFGQSTHIAFPGESDGLLPLRSKWR
FT                   DVERAALSYGYGLSVSAVQLAQAYAVIANDGVKVPLTLKKVDQPPQGEQVIGKATARQL
FT                   VQMLETVVSRVGTARRAQVPGYQVAGKTGTVHKVVNGGYADDNYIGLFAGLAPATDPRI
FT                   VTVVVIDDPAGDAYYGGLVAAPAFSRIMSGVLRSLHVPPDKPDGLLAGGPDGEDRS"
     atgaagaaac aggcccgcaa gatacggcaa ccgaatcacc tgatgcgctg gcgctttgtg        60
     ctgggcttct ggtcggtgtg tgcctgcctg ttgttaattc gagcggtgga tcttcaggtt       120
     attcagcatg attttttggc ccaccaaggg gacatccgca acctgcgggt ggagccgctg       180
     gcggctcatc ggggtgtaat tcgtgatcgt gcgggtaagc cattggcggt gagtacaccg       240
     gtggtgacgc tctgggtgaa tccccgcgaa gcgatggagc accaggatca gtgggggcgt       300
     ttggccggta attcggtgat tgatcagaaa gcgtttgccc gcaaggttcg ccgccataag       360
     tcccgtgaat ttatctattt ggagcggggg ttagcaccgg aaacggccaa gacagtgttg       420
     agtttaaatg tgcccggtgt ctatgcattg acagaatacc gtcgctatta cccggccggt       480
     gaagtggcaa gccatgtggt gggcttcacc aatatcgatg atcaagggca agaaggtatt       540
     gagctggctc ttgaagatca tttgtccggg cattccggtc gtaagaaggt ggtgcgggat       600
     ctgttgggcc gggtgattca ggatatcgaa gtgctggaac cggcggaacc gggtgaagat       660
     gtcacgctca gcatcgacct tcgcctgcag tatctggcct accgagaact gctcggagcg       720
     gtacaaaaat ttaatgcgaa agggggcagt gcggttgtgt tggatgtgcg caccggcgaa       780
     gtattagcca tggtgaatca gccagcctac aaccccaata atcgtggcaa cctggatacc       840
     ggggcgctgc gtaatcgcgc tgtgactgac ctgttcgaac caggctccac catgaagccc       900
     tttactgtgg cggcggcgtt ggaaatgggc atggtcacgc cgtccactac cattaatact       960
     catccaggca cactgcgggt gggcagcaaa acgattcgag atcaccgtga ttacggtgtt      1020
     atcgatatca ccactgtgct cactaaaagt tccaacgtgg ggaccagcaa gctggcgtta      1080
     gccatggatt cgcaggcatt gccgggctac ctggagcgct ttggtttcgg gcaatccacc      1140
     cacattgcgt ttcctggcga aagcgatggg ctgttgccgc tgcgcagtaa atggcgcgat      1200
     gttgaacgag cggccctgtc ctatggttac ggtttgagtg tctctgcggt gcagttggct      1260
     caggcctatg cggtgatcgc taacgatggc gtcaaagtgc cgttgacctt gaagaaagtg      1320
     gatcagccgc cgcagggtga gcaggtgatc ggcaaggcga cggctcgcca gctggtacag      1380
     atgttggaaa cggtggtcag tcgtgttggc accgcgcgcc gggcccaggt gccaggctat      1440
     caggtggcag gcaagaccgg caccgtgcac aaggtggtga acggtggtta cgccgatgat      1500
     aactatattg gtctgtttgc tgggttggcc ccggcaacgg acccgcgcat tgtcaccgtg      1560
     gtggtgattg atgatccggc gggtgatgcc tattacggtg ggctcgttgc ggcgccggca      1620
     ttttctcgca ttatgagtgg cgtgttgcgc tcgctccatg tgccaccgga caagcctgac      1680
     gggctgctgg ccggcgggcc ggacggggag gatcgctcat ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page