(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSL

AM286690.FTSL        Location/Qualifiers
FT   CDS_pept        647599..647865
FT                   /transl_table=11
FT                   /gene="ftsl"
FT                   /locus_tag="ABO_0591"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16039"
FT                   /db_xref="GOA:Q0VS09"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS09"
FT                   /protein_id="CAL16039.1"
FT                   /translation="MAAPWMIRVLVVMVVMSALGVSYSVHQARRLTDESQRLQQRQTRL
FT                   ETQWSQLLLEHSTWGSYARVERLAREKLGMKLPKTNERVLIRP"
     atggcggcgc cgtggatgat tcgcgtattg gtcgtgatgg tcgtgatgtc tgcgctgggt        60
     gtcagttata gcgtgcatca ggcgcggcgt ctcacggatg aaagtcaacg tttacagcag       120
     cgacagactc gattggaaac ccagtggagc caattgttgt tggagcacag cacctggggt       180
     agttacgccc gggtggagcg cctggctaga gaaaagctgg gcatgaagtt acctaagacg       240
     aatgagagag tgctgatcag gccatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page