(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSQ

AM286690.FTSQ        Location/Qualifiers
FT   CDS_pept        659380..660156
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ABO_0601"
FT                   /product="cell division protein FtsQ"
FT                   /function="This protein may be involved in septum
FT                   formation."
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF03799"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16049"
FT                   /db_xref="GOA:Q0VRZ9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VRZ9"
FT                   /inference="protein motif:HMMPFAM:HMMPF03799"
FT                   /protein_id="CAL16049.1"
FT                   /translation="MAKNAPAPRGARRKPVKKVGVPLRERVATAVPWMLVGSVAMVSLL
FT                   AVIYLPAALDGYPIRKVGVDGVTDVRRQQQIETALAALVREENYFSVPLEEIYQQSQGL
FT                   SWVEEVSVRRQWPDTVVLTVEERRPVAVWNESVLVSDSGQPFKALKQYDLDDLPHLNGP
FT                   EQRLEEVMGFYHSMGKTLADVDLSIRSMEVNARLTARLTLNNDMELVVDREHYTTKLRR
FT                   FVRLYRGVLNTDSRQVARVDLRYADGMAVTWREQQS"
     gtggctaaaa acgcgcccgc gccgcgtggc gcccgccgca agccggttaa aaaggtcggc        60
     gtaccgctgc gcgagcgggt ggcaacggcg gtgccatgga tgctggtcgg ctcggtggcg       120
     atggttagcc tgctggcggt gatctacctg cccgcggcgc tggatggtta cccgatccgc       180
     aaggtgggcg tggatggtgt gaccgatgtg cgccgtcaac agcagataga aaccgcgttg       240
     gcggcgctag tgcgtgaaga aaattatttc tctgtgccgc tggaggaaat ctaccagcaa       300
     tctcagggat taagctgggt ggaagaggtt tccgtccgcc gtcagtggcc cgataccgtg       360
     gtgctgacgg tagaagaacg acgcccggtg gccgtgtgga atgagtcggt gttggtgtcg       420
     gacagcgggc agccgttcaa ggcactgaag cagtacgacc tggacgatct gcctcacctg       480
     aatggcccgg aacagcggtt ggaggaagtc atgggcttct accacagcat gggcaaaacg       540
     ctggcggatg tggatttgag cattcgtagt atggaggtca atgcgcgcct gaccgcgcgc       600
     ctgacgctga ataacgacat ggaactggtg gttgaccgtg agcattacac caccaaatta       660
     cgccgttttg tgcggcttta tcgtggcgtg ctgaacacgg atagccgtca ggtagctcgg       720
     gtcgatttgc gttatgcgga cggcatggca gtgacctggc gcgagcagca aagttag          777
//

If you have problems or comments...

PBIL Back to PBIL home page