(data stored in ACNUC7421 zone)

EMBL: AM286690.FTSW

AM286690.FTSW        Location/Qualifiers
FT   CDS_pept        654830..655987
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ABO_0597"
FT                   /product="cell division protein FtsW"
FT                   /function="Bacterial cell division membrane protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01098 InterPro: Cell cycle proteins"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16045"
FT                   /db_xref="GOA:Q0VS03"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS03"
FT                   /inference="protein motif:HMMPFAM:HMMPF01098"
FT                   /protein_id="CAL16045.1"
FT                   /translation="MTERMILKVDHTGIDKPLLWTAILLALAGLVMVSSASLQIAETRL
FT                   GDPFYYAMRHGIYLALGLGVGAFVYYAVPLALLERLRFVMLPVALVALVMVFIPGLGRT
FT                   VNGSTRWIALPGLTIQASEIVKLCFVLYLAGYVAQRKAALETEWKAFLLPLGLLGVLML
FT                   LLLLEPDFGAVVVLGITAMGMLFLSGVPTLRFLLIGLIAVALGGLVAFAEPYRVARLMT
FT                   FTDPWADQFGSGYQLTQSLIAFGRGHWFGVGLGNSVQKLFYLPEAHTDFVYAVMSEELG
FT                   LLGNVALIGGFILLGWRVFRIGHRLEARGLLYHAYLVYGCAFVFCSQAFINLGVNMGLL
FT                   PTKGLTLPFISYGGSSLLISAVMVGLILRAGAEADHLKARGRAAR"
     atgactgagc gcatgatcct gaaagtagac catacgggga tcgacaaacc gctgttgtgg        60
     acggctattt tgttggctct ggcagggcta gtgatggtgt catccgccag tttgcagatt       120
     gctgaaactc gtttaggtga ccccttttat tacgccatgc gccatggcat ttatttggcg       180
     ctgggcctgg gtgtaggcgc ctttgtatat tacgcggtgc cgctggcact gcttgagcgt       240
     ttgcgctttg tgatgctgcc tgtggcgctg gtggcattag tgatggtgtt tattcccggg       300
     ctgggccgta cggtgaatgg ttccacccgc tggatcgctt tgccaggcct gaccattcag       360
     gcttcagaaa tcgtcaaact gtgctttgta ctttatctag cgggatatgt ggcgcaacgc       420
     aaagccgcgt tggaaacgga atggaaggcc ttcttgctgc cgctgggttt gctgggtgtg       480
     ctgatgctgc tgttgctgct ggagccggat ttcggcgcgg tggtggtgtt gggaattacc       540
     gccatgggca tgttgttttt gtctggcgtg ccgactctgc ggttcttgct gatcggtttg       600
     attgcggtgg cacttggcgg attggtcgcc tttgccgaac cttaccgggt ggcacggttg       660
     atgaccttta ccgacccttg ggcagaccag tttggttctg gctatcagct gacccagagt       720
     ctgattgcgt ttggtcgagg gcactggttt ggtgtggggc taggtaacag tgtacagaag       780
     ctattttacc tgccagaagc ccatacggat tttgtctatg cagtgatgtc tgaagagctg       840
     gggctgctgg gaaatgtggc gctaatcggt ggttttattc tgctgggttg gcgggtgttc       900
     cggattggcc accgtttgga agcgcgcgga ttgttgtacc acgcctacct agtctatggc       960
     tgtgccttcg tattttgctc ccaggcattt atcaacctgg gcgtgaacat ggggctgctg      1020
     cccaccaagg ggctgaccct gccctttatc agctatgggg ggtcttccct gttgatttcc      1080
     gccgttatgg tggggctgat tttacgagcc ggagcggaag cggaccacct gaaagccaga      1140
     gggagggctg cacgatga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page