(data stored in ACNUC7421 zone)

EMBL: AM286690.FUR

AM286690.FUR         Location/Qualifiers
FT   CDS_pept        336676..337077
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="ABO_0309"
FT                   /product="transcriptional regulator Fur"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15757"
FT                   /db_xref="GOA:Q0VSU1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU1"
FT                   /protein_id="CAL15757.1"
FT                   /translation="MDNQDLRKAGLKVTLPRVKILQQLEKSAERHLSAEDIYKSLMDSG
FT                   EDVGLATVYRVLTQFEQAGMVLRHNFEGGSAVFELADEEHHDHMVCMETGAVVEFMDDV
FT                   IESRQHAIAEEYGYEIVDHSLVLYVKPKK"
     ttggataatc aggatcttag aaaagcgggc cttaaagtga ccctgccgcg ggtgaaaatc        60
     cttcagcagc tggagaagtc cgcagagcgc cacttgagcg cggaagatat ctacaagtcg       120
     ttgatggatt ccggcgaaga cgtgggcttg gcgacggtat atcgcgtgct gacgcagttc       180
     gagcaggctg gcatggtgtt gcgccacaac tttgaaggtg gctctgctgt attcgagctg       240
     gctgatgaag agcaccatga tcatatggtg tgcatggaaa ccggcgcggt ggtcgaattt       300
     atggatgacg tgattgagtc gcgccagcat gctattgccg aggagtatgg ttacgagatt       360
     gtggatcact cactggtgct gtacgtcaaa cccaagaagt ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page