(data stored in ACNUC7421 zone)

EMBL: AM286690.FUSA

AM286690.FUSA        Location/Qualifiers
FT   CDS_pept        428696..430795
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="ABO_0382"
FT                   /product="elongation factor (EF)"
FT                   /function="This protein promotes the GTP-dependent
FT                   translocation of the nascent protein chain from the a-site
FT                   to the p-site of the ribosome."
FT                   /EC_number="3.6.5.3"
FT                   /note=", (fus), (far) (translation elongation factor G),
FT                   (elongation factor G) identified by sequencesimilarity;
FT                   putative InterPro: Translation elongation factor G"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15830"
FT                   /db_xref="GOA:Q0VSL8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSL8"
FT                   /protein_id="CAL15830.1"
FT                   /translation="MARKTPLNRYRNIGICAHVDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWQGMDQQYDQHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQANKYEVPRIVFVNKMDRAGADFDSVCNQIRKRLG
FT                   ASVVPIQYNIGAEDNFKGVVDLIRMKAIFWNEEDMGMTYEEKDIPDDIKDRCDELREQM
FT                   TEAAAEGSEELMEKYLEEGDLSNDEIKAGLRQQVLANEIVLGLCGSAFKNKGVQALLDA
FT                   VIEFLPAPDEVKAIQGVLPDGETVEARKSSDDEPFSALAFKIATDPFVGSLTFIRVYSG
FT                   VLNSGDSVLNSVREKKERVGRLLQMHANSREEIKEVLAGDIAACVGMKDVTTGDTLCDL
FT                   KNPIVLERMEFPEPVISVAVEPKSKADQEKMGLALGRLAQEDPSFRVKTDEETGQTIIS
FT                   GMGELHLDILVDRMRREFKVEANIGAPQVAYRETFTRGADVDGKFVKQSGGRGQYGHVK
FT                   VKFEPIDRDEEFQFEEQIHGGSVPKEYFGAVQKGIDEQLQAGVLAGYPILGVKATLYDG
FT                   SYHEVDSNENAFRMAGALAVKNAAKEAGAVLLEPIMKVEAVTPEDYMGDVMGDLNRRRG
FT                   IVQGMEDTMAGKIIRAEVPLSEMFGYATDLRSMSQGRASYSMEFLKYAEAPKNIADEVI
FT                   SGKKS"
     gtggctcgta agactcctct caatcgctat cgtaatattg gtatctgtgc gcacgtagat        60
     gcgggcaaga cgaccactac cgagcgtatt cttttttaca ccggtgtgtc tcacaaaatt       120
     ggtgaggtgc atgatggtgc tgccaccatg gactggatgg agcaggagca ggagcgtggt       180
     attaccatta cctctgctgc gaccaccacc ttttggcagg gtatggatca acagtacgac       240
     cagcaccgaa tcaatatcat tgatacccca gggcacgttg acttcactat tgaggttgag       300
     cgttctctgc gtgtgcttga tggtgcggtt gttgtgttct gtggttcctc tggtgttgag       360
     ccgcagtcag agactgtatg gcggcaggcc aataagtacg aagtgccgcg tatcgtgttc       420
     gtcaataaga tggaccgtgc tggcgcggac ttcgactctg tttgtaacca gattcgtaag       480
     cgtctgggtg ccagtgtcgt gccgattcaa tacaatatcg gcgcagaaga taacttcaag       540
     ggtgttgtcg acctcatccg tatgaaggcg atcttctgga atgaagaaga catggggatg       600
     acctacgaag agaaggatat cccggacgac atcaaagacc gttgtgacga acttcgtgag       660
     cagatgaccg aagctgcggc ggaaggttct gaagagttga tggaaaagta cctggaagaa       720
     ggtgaccttt ccaatgacga aatcaaggcg gggctgcgtc agcaggttct ggctaatgaa       780
     atcgttctcg gcctttgcgg ttctgcgttc aagaacaagg gtgttcaggc cctgcttgat       840
     gcagttatcg aatttctgcc agcaccggac gaagttaaag ctatccaggg tgtgttgccg       900
     gatggcgaaa ccgttgaagc gcggaaatct tccgatgatg agccgttctc ggctctggca       960
     ttcaagattg ctaccgaccc cttcgtaggt tcattgacct ttattcgtgt ttactcaggc      1020
     gtgttgaact ctggtgacag tgttcttaac tctgtgcgtg agaaaaaaga gcgtgtaggt      1080
     cgtttgctgc aaatgcatgc gaacagccgc gaagagatta aagaagtgct ggcgggcgac      1140
     attgctgctt gtgtgggcat gaaagatgtc actacaggcg acactctgtg tgacttgaaa      1200
     aacccaattg ttcttgaacg catggaattc ccagagccgg taatctctgt tgcggtagag      1260
     ccgaagtcca aagccgacca ggaaaaaatg ggtctggcgc tgggtcgcct ggcgcaggaa      1320
     gatccgtctt tccgtgtgaa gaccgacgaa gaaaccgggc agaccatcat ttctggtatg      1380
     ggtgagctgc acttggatat tcttgtcgat cgtatgagac gtgaattcaa agtggaagcg      1440
     aacatcggtg cgccgcaggt tgcgtatcgt gaaaccttca cccgcggtgc ggatgtggat      1500
     ggtaagttcg tcaagcaatc cggtggtcgt ggtcagtacg gtcacgtcaa agttaagttc      1560
     gagcctattg atcgtgatga agagttccag tttgaggagc aaattcacgg tggctccgta      1620
     ccgaaagaat actttggtgc cgtgcagaag ggtatcgacg aacagcttca ggctggtgtg      1680
     cttgcgggct atccgattct gggtgtgaaa gcgactctgt acgatggttc ctaccatgag      1740
     gtggattcca acgaaaacgc tttccgtatg gctggcgcgc ttgctgttaa gaacgcagcg      1800
     aaggaagcgg gtgctgtgct gcttgagccg attatgaagg tggaagcggt aactccagaa      1860
     gattacatgg gcgacgtgat gggtgacttg aatcgtcgcc gtggtatcgt tcagggcatg      1920
     gaagacacca tggctggcaa gattattcgt gccgaggtgc ctttgtctga aatgttcggt      1980
     tacgctactg atctgcgttc catgtctcag gggcgtgcta gttactccat ggagttcctg      2040
     aagtacgctg aagcaccgaa gaatatcgct gatgaagtca tcagcggcaa aaaatcttaa      2100
//

If you have problems or comments...

PBIL Back to PBIL home page