(data stored in ACNUC7421 zone)

EMBL: AM286690.GATA

AM286690.GATA        Location/Qualifiers
FT   CDS_pept        complement(581020..582495)
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="ABO_0528"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /function="Assembled with B and C subunits = ATP +
FT                   l-glutamyl-tRNA(gln) + l-glutamine = ADP + phosphate +
FT                   l-glutaminyl-tRNA(gln) + l-glutamate"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Glutamyl-tRNA(Gln) amidotransferase A subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15976"
FT                   /db_xref="GOA:Q0VS72"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS72"
FT                   /protein_id="CAL15976.1"
FT                   /translation="MHTKTLTELKAGLAAGDFSSRELTEHFLARIKQYDGELNSFVTVT
FT                   EEQALAQADAADATLATNRASSSVSGLLTGLPIAHKDIFCTEGVRTSCGSKMLDNFIAP
FT                   YTATVVEKMAAEGAVMLGKTNMDEFAMGSSNETSYYGPVKNPWDLERVPGGSSGGAAAC
FT                   LGARLAPAATGTDTGGSIRQPAALNNITGLKPTYGRVSRWGMIAFASSLDQAGPMAQSA
FT                   EDCALMLQAMAGHDHRDSTSLNEKVGDYLGALKDDIRGLTIGIPEEFFPDTLDGAIADN
FT                   SRDAIRELEKLGAKVVSVSLPSIKLSVPAYYVIAPAEASANLSRFDGVRFGHRCDDPQD
FT                   LEDLYKRSRSEGFGDEVKRRILVGAYALSAGYYDAYYRRAQQVRSLIRDDFARAFEKVD
FT                   VLMGPTAPETAFKLGAKKDDPVSMYMADVFTIGVNLAGLPALSMPTGFINGLPTGTQII
FT                   GNYFREGQILNVAHKYQQATDWHKQAPAFGGAQ"
     atgcatacca aaaccctgac cgaactcaag gctggcctag ctgccggaga tttttcctcc        60
     cgcgagttga ccgaacactt cttggcccgc atcaaacagt atgacggcga actcaacagc       120
     tttgtcaccg tgaccgagga acaagcactg gcccaagcgg atgccgccga tgcaaccctt       180
     gccactaacc gtgcatcctc ctcagtgagc ggcctgctca ccggcctgcc catcgcccac       240
     aaggatattt tctgcaccga gggcgtgcgc accagctgtg gctcaaaaat gctggacaac       300
     tttattgccc cctacaccgc caccgtggtg gaaaaaatgg cggctgaagg cgccgtcatg       360
     ctgggcaaga ccaacatgga cgagttcgcc atgggctcct ccaatgaaac cagttactac       420
     ggcccagtga aaaacccatg ggatctagag cgggtgcctg gcggctcctc cggcggcgca       480
     gccgcttgcc tgggcgcccg cctagcgcct gctgctaccg gcaccgacac cggcggctcc       540
     attcgccaac ctgcggcgct gaataacatc accggcctca aacccaccta cgggcgagtc       600
     tcacgctggg gcatgattgc ctttgcttcc agcctggacc aagccggccc catggcccaa       660
     agcgctgaag actgtgcgtt gatgctgcaa gccatggccg gccacgatca ccgcgattcc       720
     accagcctca acgaaaaggt gggcgattat cttggcgccc ttaaagacga catccgcggc       780
     ctgaccattg gcatcccgga agagtttttc ccagacaccc tggatggcgc tatcgccgac       840
     aacagccgtg acgcgatccg cgaactggaa aaactcggcg caaaagtagt atccgtctcc       900
     ttacccagca tcaagctatc cgtaccagcc tactatgtga ttgccccggc agaagccagt       960
     gccaacctta gtcgttttga cggtgtacgt ttcggccatc gatgtgatga cccacaggat      1020
     ctggaagacc tgtacaagcg ctctcgctca gaagggtttg gtgatgaagt aaaacggcgc      1080
     atcttagtcg gcgcctacgc gctgtccgct ggttactacg acgcatacta tcgccgcgcc      1140
     caacaagtgc gcagtttaat ccgtgacgac tttgcccgcg cctttgaaaa agtagatgtg      1200
     ctgatgggac ccacagcgcc tgaaaccgcc ttcaagctcg gagcgaagaa agatgatccg      1260
     gtcagcatgt acatggccga cgtgttcacc atcggcgtta acttagccgg ccttcctgcg      1320
     ctgtccatgc ccacgggatt catcaacggc ctgcccaccg gcacccagat catcggcaac      1380
     tatttccgtg aagggcaaat tcttaacgtg gcccacaaat accagcaggc cacagactgg      1440
     cacaaacaag cgccagcgtt tggaggtgca caatga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page