(data stored in ACNUC7421 zone)

EMBL: AM286690.GLMM

AM286690.GLMM        Location/Qualifiers
FT   CDS_pept        355072..356406
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="ABO_0324"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="catalyses the interconversion of
FT                   glucosamine-6-phosphate into glucosamine-1-phosphate in the
FT                   biosynthetic pathway leading to the synthesis of
FT                   UDP-N-acetylglucosamine"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Phosphoglucomutase and phosphomannomutase family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15772"
FT                   /db_xref="GOA:Q0VSS6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSS6"
FT                   /protein_id="CAL15772.1"
FT                   /translation="MTRKYFGTDGVRGTVGEFPITPDFVLKLGWAAGKVLGARGGSKIL
FT                   IGKDTRISGYMFESALEAGISAAGVDVRLLGPLPTPGIAYLTRTLSAQAGIVISASHNP
FT                   YTDNGIKFFGADGRKLNDEIELEIERLLDEQMSVVSTDQIGKVRRIDDARGRYIEFCKS
FT                   TAPGLDLNGMKIVVDTANGAAYHIAPDVFEELGATVVPLANQPDGFNINRDCGSTHPEA
FT                   LQRKVVEEKADLGVALDGDADRLLMVDHAGNLVDGDQLLFVVARDRKENGAEMDGVVGT
FT                   LMSNFGLELALQAEGIEFVRAKVGDRYVMEQLDKRGWNIGGESSGHLVCLDCTTTGDGT
FT                   VSALQVLAALSRRKQGLAESVADVSMLPQKMINVRGPNRDGFMENGDVQAAMADVEDRL
FT                   AGNGRILLRPSGTEPLVRVMIEGKDVDRVESLCRELAEVVEKAIN"
     atgacgcgca aatatttcgg caccgacggg gtgcgaggta cggtggggga gtttcccatt        60
     acgcctgatt ttgtgctcaa gctgggctgg gctgccggca aggtactggg ggctcgtggt       120
     ggcagcaaga tattgattgg taaagatacc cgtatttccg gctatatgtt tgagtcagcc       180
     ttagaagcgg ggatctctgc agctggagtg gatgtgcgct tgttggggcc gttgcccacg       240
     ccgggaattg cctatttgac gcgcacactt tcggctcaag ccggcattgt gatttctgcg       300
     tctcataacc cttatacgga taacggcatt aagtttttcg gggcggatgg tcgaaagctc       360
     aatgatgaaa ttgagctcga aattgagcgc ttgctggatg agcaaatgtc ggtggtgtcc       420
     acggatcaga tcggtaaggt gcgacgtata gatgatgccc gcggtcgtta tattgaattt       480
     tgcaaaagca cggcgccagg cctagacctt aatggaatga aaattgtggt ggataccgcc       540
     aacggtgcgg cttaccacat tgccccggat gtgttcgaag agctaggcgc cactgtggtg       600
     ccgctggcta atcagcccga cggcttcaat attaatcgcg attgtggctc tactcatccc       660
     gaggcgttgc agcgcaaggt tgtggaagaa aaagccgatc tcggtgtggc gctggatggc       720
     gatgcggatc gattattgat ggtcgatcat gctggtaacc tagttgatgg tgaccagctg       780
     ttgtttgtgg tggcccgcga tcgcaaagaa aacggcgcgg aaatggatgg ggtcgtagga       840
     acgctaatgt ccaacttcgg gttggagctg gcgctgcagg ctgaaggcat tgaatttgta       900
     cgcgccaagg tcggtgatcg ttatgtcatg gagcagttgg ataagcgtgg ctggaacatc       960
     ggtggcgaat cctccgggca tctggtgtgc ctggattgca ccaccacggg ggatggaacc      1020
     gtctctgcat tgcaggtgtt ggcggccttg tcccgtcgta agcaaggctt ggccgagtct      1080
     gtcgcagacg tgtccatgct cccccagaag atgatcaatg tacgtggccc aaatcgtgat      1140
     ggatttatgg aaaatgggga tgtgcaggcg gccatggcag atgtagaaga taggctggcc      1200
     ggtaatggcc gtatcctgtt gcgaccctcc ggcactgagc ctttggtgcg ggtgatgatt      1260
     gaaggcaagg atgtggatcg ggtggaaagc ctgtgccgtg agctggccga agtggtggaa      1320
     aaggcaatca attaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page