(data stored in ACNUC7421 zone)

EMBL: AM286690.GLYS

AM286690.GLYS        Location/Qualifiers
FT   CDS_pept        complement(8198..10270)
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ABO_0008"
FT                   /product="glycyl-tRNA synthetase"
FT                   /function="atp + glycine + trna(gly) = amp + diphosphate +
FT                   glycyl-trna(gly)"
FT                   /EC_number="6.1.1.14"
FT                   /note="(glycyl-tRNA synthetase tetrameric type betasubunit)
FT                   identified by match to TIGR protein family HMMTIGR00211
FT                   InterPro: Glycyl-tRNA synthetase beta subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15456"
FT                   /db_xref="GOA:Q0VT23"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT23"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00211"
FT                   /protein_id="CAL15456.1"
FT                   /translation="MSRDLLIELGTEELPPKALASLSAALTDEFVRQLDEAGLNHGAVE
FT                   RFAAPRRLALLVRDLDEKQADRDIERQGPAVQAAFDSDGNPTKAAQGFAASLGLTVDQL
FT                   GRQDTGKGERLVAQITEQGKSAAELIPAFFTQSIQKLPIPKRMRWGKRKVQFVRPAHWL
FT                   VALFGDEVIPFELLDLQSGRTSYGHRFHAPGAIELASASEYAQRIENDGHVLADFDRRK
FT                   AMIKEQTLAAGKEAGGVAQINPDLLNEVTALVEWPEALMGSFDDDFLRVPQEALISAME
FT                   EHQKYFSVLDNDGKLMPRFITISNIQSKDPQQVIHGNEKVIRPRLADAAFFYDNDCKRT
FT                   LAQHAEGLTNVVFQQQLGTVAEKCERIGGLAAVIAENIGGDVDNAKLAGKLSKADLNSE
FT                   MVGEFDTMQGIMGFYLAQREGQPKEVANALYEQYLPRFAGDTLPQSKTGMAVSLADKID
FT                   TLVGIFGIGQKPSGTKDPYALRRATLGVLRIIIEHELALDLRELLDKAAEQLGERIDTA
FT                   QVDDAFEFIKGRYRAIYQEQGIATPVILSVLAIDDACRKPLDFDRRVKAVAAFQQRDEA
FT                   QALAAANKRVSNILAKLETAPAEEIDGALLEDEAEKTLTNMVVAAFEQTYELLEAGDYA
FT                   SVLEMLAQLREPVDTFFDTVMVMAEDEAVRNNRLALLAFLRDLFLNVADISLLQE"
     atgtcccggg atttactgat tgaattgggc accgaagagc tgcccccgaa agcgctggcc        60
     tcactgagtg ccgcgctcac tgatgaattt gtccgccaac tggatgaagc tggcctgaac       120
     cacggtgctg tagaacgttt tgccgcccct cgccgtctgg ctttgctggt gcgggatctg       180
     gatgagaaac aggccgaccg cgatatcgag cgccagggcc ctgcggtgca ggcagccttc       240
     gacagcgacg gcaacccaac caaagccgcc caaggctttg ccgcctcgct gggactgacc       300
     gtagaccagc tcggccgcca ggacaccggc aagggtgagc gcctagtggc acagatcacc       360
     gagcagggca aaagcgccgc cgaactgatc cccgcctttt tcacccagtc catccagaag       420
     ctgccgatcc ccaaacgcat gcgttggggc aagcgcaagg tgcagtttgt gcgcccggcc       480
     cattggctgg tggcgttatt tggtgacgaa gtcattccgt ttgagctgct ggatctgcaa       540
     tctggccgca ccagctatgg ccaccgcttc catgctccag gcgctatcga actggcctct       600
     gccagcgaat atgcccagcg catcgaaaac gacggtcacg ttctggcaga ttttgaccgc       660
     cgtaaggcca tgattaaaga acagaccttg gcggccggca aagaagccgg cggggtcgcc       720
     cagatcaatc cagacctgct caacgaagtc accgctcttg tggaatggcc cgaggcactc       780
     atgggtagct ttgatgatga cttcctgcgc gttccccagg aagccctgat cagtgctatg       840
     gaagagcacc agaaatattt ttcggtactg gataacgacg gcaagctgat gccccgcttt       900
     attaccatca gcaatatcca gtccaaggat ccgcaacagg tgatccacgg taacgagaag       960
     gtcatccgtc cgcgcttggc cgacgccgcc ttcttttacg acaacgattg taagcgcact      1020
     ttggcacagc acgccgaagg cttgaccaat gtggtattcc aacagcagct aggcaccgtc      1080
     gccgaaaagt gcgaacgcat tggtggcctg gccgccgtga tcgccgagaa catcggtggc      1140
     gacgtggaca acgctaaact ggccggaaag ctcagcaaag ccgacctgaa cagcgaaatg      1200
     gtcggcgaat tcgacacgat gcagggcatc atgggcttct atctggccca gcgggaaggt      1260
     cagccgaaag aggtggctaa cgccttgtat gaacagtacc tgccacgttt cgccggcgac      1320
     accttgccgc aaagcaaaac cggcatggct gtttccttgg ccgacaaaat cgataccctg      1380
     gtgggcatct tcggtattgg ccaaaaaccc agcgggacca aagaccccta tgcgctacgt      1440
     cgcgctacct tgggcgtgct gcgcattatc atcgaacatg aactggcgct tgacctgcgt      1500
     gagctactgg ataaagcagc cgaacaattg ggcgagcgta ttgataccgc ccaagtggat      1560
     gatgcttttg agttcatcaa aggccgttac cgcgccattt atcaggaaca aggcatcgct      1620
     accccggtga tcttgtcggt gctggccatc gacgatgctt gccgcaagcc actggacttc      1680
     gaccgtcggg tgaaagccgt ggcggccttc caacaacgtg acgaagcgca agcactagcg      1740
     gctgccaaca agcgcgtctc taacatcctt gccaagctgg aaaccgcacc cgccgaagaa      1800
     atcgatggcg ccttgctgga agatgaagca gaaaaaacgt tgaccaatat ggtcgtggcc      1860
     gcattcgaac agacctacga actgctggaa gccggcgact acgccagcgt gctggaaatg      1920
     cttgcgcaac tgcgtgagcc tgtagacacc ttttttgaca ccgtcatggt gatggcggaa      1980
     gacgaagctg tgcgtaataa ccggttagcg ttgctcgcct tcctgcgaga tctgttcctg      2040
     aatgtggcgg atatcagttt gttgcaggaa taa                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page