(data stored in ACNUC7421 zone)

EMBL: AM286690.GYRB

AM286690.GYRB        Location/Qualifiers
FT   CDS_pept        3785..6202
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ABO_0004"
FT                   /product="DNA gyrase, subunit B"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: DNA topoisomerase II"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15452"
FT                   /db_xref="GOA:Q0VT27"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT27"
FT                   /protein_id="CAL15452.1"
FT                   /translation="MAEKKYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGFCSEIKVVIHPDESMSIQDNGRGIPTEMHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNTYKVSGGLHGVGVSVVNALSEELKLTIRRNGQVHEQIYNHGVPAKPLEVVGTTDS
FT                   SGTAVHFRPSPETFSNIKFHYDILAKRLRELSFLNSGVRIHLMDERSGDEDVFEYEGGL
FT                   SAFVSYLNTNKTPLNQVFHFNYEREEDGIAVEVAMQWNDSYQENIFCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNSYMDKEGFLKKEKASPSGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGDLFQDYLLENPGEARSIVQKIIDAARARDAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQQKDPALSELYIVEGDSAGGSAKQGRDRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVGTLITALGCGIGRDEYNIEKLRYHRIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYVYIAQPPLYKVKKGKQETYLKDDPAMEEYLTTLALDKTGLYPGNDAPPI
FT                   SGEPLAKLIAEYRGVMKIVDRQSRVFPEEVLEQMIYMPSLSESSLNDEAAMMQWCETLG
FT                   KRVDAITDATQTFTITAQRDEERGLYLPRVQVLAHGVPREYKVTLDFLQSPDYQKIKAL
FT                   GETLEGLLAEDAYIQRGESQRPIRHFAEALDWLMAQARRGTSFQRYKGLGEMNADQLWE
FT                   TTMDPESRRMLQVTIEDAIAADQIFTCLMGDDVDPRRRFIESNALQVSNLDV"
     atggcggaga aaaaatacga ttcatccagc attaaggtgc tgaaaggatt ggatgccgta        60
     cgtaaacgtc caggcatgta tatcggtgat acggatgatg gcacaggcct gcaccacatg       120
     gtgtttgagg tcgtagataa ctccatcgat gaagctctcg ccgggttttg ctctgaaatc       180
     aaagtggtta tccatcccga tgagtccatg tctatccaag ataatggtcg tggcattcct       240
     accgaaatgc acgaggaaga aggtgttagt gcagcagaag tgatcatgac ggtgctgcac       300
     gctggtggta aattcgacga taacacctac aaggtgtccg gtggccttca cggtgtaggc       360
     gtatcggtgg tgaatgcttt gtcagaagag ctgaaactga ctattcgccg taatggccag       420
     gtccacgagc agatttataa tcacggggtg ccagcaaaac cacttgaagt agtgggcacg       480
     acagattcca gcggcaccgc ggtgcacttc cgtccttctc cggaaacctt cagcaatatc       540
     aaattccatt acgacattct tgccaagaga ctgcgtgagc tgagtttcct gaactctggt       600
     gtgcgtattc atctgatgga tgagcgtagc ggtgatgagg atgttttcga gtatgaaggt       660
     ggcttaagcg cctttgtcag ctacctgaat accaataaaa ccccgctaaa tcaggtattc       720
     cacttcaatt acgagcgcga agaggatggt attgcggtag aagtggccat gcagtggaat       780
     gattcctatc aggaaaatat cttctgcttt accaataata ttcctcagcg cgatggtggt       840
     actcacctgg caggctttcg ggcagcgctg acccggacct tgaacagcta catggacaag       900
     gaggggttcc tcaagaagga aaaagctagt ccatccggtg atgatgctcg ggaagggctg       960
     actgcggtga tttccgtgaa agtgccggat cccaagttct ccagccagac taaagataag      1020
     ctggtgtcct ccgaggtgaa aagcgctgta gagcaaacta tgggtgatct cttccaggat      1080
     tatttgctgg aaaacccagg tgaagcacgc agtattgtgc aaaaaatcat cgatgcggcc      1140
     cgcgcccgtg acgcggctcg taaagcccgt gagatgactc ggcgtaaagg cgcgctggat      1200
     atcgctggcc tgcccggaaa attggctgat tgccagcaga aagatccggc gttgtctgaa      1260
     ctctacattg tggagggtga ttctgcgggt ggttcggcca agcagggtcg agaccgcaag      1320
     aaccaggcga ttttgccgct caagggtaaa attctgaacg tggaaaaagc ccgtttcgac      1380
     aagatgctgt cttctcagga agtgggcacc ctgattacgg ctctgggctg tggtattggt      1440
     cgagatgagt acaatatcga aaagctgcgt taccaccgta tcatcatcat gacggatgcg      1500
     gacgtggatg gctcacacat tcgtaccctg ctgctcacct tcttcttccg tcagctccct      1560
     gagctgattg agcgcggtta cgtctacatt gctcaaccgc cgttgtacaa ggtgaagaaa      1620
     ggcaagcaag agacctacct taaagatgat ccggccatgg aggagtattt aaccaccttg      1680
     gcactggata aaaccggcct gtatccaggc aacgatgcac caccgatcag tggtgagccg      1740
     ctggccaagc tgattgctga ataccgtggt gtaatgaaaa ttgtcgatcg ccagtcccgg      1800
     gtattcccgg aagaagtact ggagcagatg atttatatgc cgtcactcag cgaaagctca      1860
     ttgaacgacg aagctgccat gatgcaatgg tgtgagacct tgggtaaacg tgtggatgcg      1920
     attactgatg cgacccagac cttcactatt actgctcagc gggacgagga gcggggtctg      1980
     tatcttcctc gtgtgcaagt gctcgctcac ggtgtacccc gcgaatataa ggtgacactg      2040
     gatttcttgc agtctccgga ctaccagaaa atcaaggcgc tgggggaaac ccttgaaggc      2100
     ttgctggctg aggatgccta tattcaacgt ggtgagtcac agcggcctat ccgtcatttc      2160
     gcagaagctc tagactggct gatggcccag gctcgtcgtg gcaccagttt ccagcgctat      2220
     aaagggctgg gtgagatgaa cgctgaccag ctatgggaaa ccaccatgga tccggaaagt      2280
     cgccgtatgt tgcaggtgac catcgaagat gccatcgcag cggatcagat tttcacctgc      2340
     ctgatgggtg atgatgtaga cccgcgccgt cggttcatcg agtccaacgc gcttcaggta      2400
     tctaatttgg atgtgtaa                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page