(data stored in ACNUC7421 zone)

EMBL: AM286690.HEMA

AM286690.HEMA        Location/Qualifiers
FT   CDS_pept        573722..574978
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="ABO_0522"
FT                   /product="glutamyl-tRNA reductase"
FT                   /function="glutamyl-trna(glu) + nadph =
FT                   glutamate-1-semialdehyde + nadp(+) + trna(glu)"
FT                   /EC_number="1.2.1.-"
FT                   /note="glutamyl-tRNA reductase identifiedby sequence
FT                   similarity; putative InterPro: Glutamyl-tRNA reductase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15970"
FT                   /db_xref="GOA:Q0VS78"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS78"
FT                   /protein_id="CAL15970.1"
FT                   /translation="MNLVAVGVNHTTADVELRERLAFSTQQAEVALASLREMPGVREAA
FT                   LLSTCNRTELYCLTDDVTPNFAQWLASSRNLSVERLSTVLYQHTGEQALEHMMRVAGGL
FT                   DSLVLGEPQILGQMREAYARAHEAGLLNGELSRLFQEVFSVAKRIRTETGIGANPVSVA
FT                   YAAVSFARHIFADLKKSRALLIGAGEMIELVARHLSEQQVQEITIANRTQERASELAAA
FT                   VGGRGISLEELPVALERADILISCTAAPLPIMGKGMVERALKKRRHRPMFMVDIAVPRD
FT                   IEPEVGELGDVYLYTVDHLQEAIQENVRSRQQAAQEASELIRDAIVRHRRQRREQDAVK
FT                   VLRDYREQRKAMAESELEKALQQLRNGGDAEQVLRRFQHSLVNKWLHSPSVTLRKMAAD
FT                   GRAEALLLARELLLDDDQS"
     atgaatctag tcgctgtcgg cgtaaatcac accaccgcgg atgtggaact acgcgaacgt        60
     ctggcgtttt caacgcagca ggcggaggtg gcgttggcca gcttgcgtga gatgcccggg       120
     gtgcgggaag ctgcattgct gtctacctgt aaccgcaccg aactgtattg cctcactgac       180
     gacgtcactc caaattttgc tcaatggctg gcctctagcc gcaatctgtc cgtcgaacga       240
     ctctccacgg tgctgtatca gcataccggt gagcaggcgc tggagcatat gatgcgggta       300
     gctggcggtc tggattcgct ggtactgggc gagccacaaa ttcttggtca gatgcgtgaa       360
     gcctatgctc gagcccatga ggctggcttg ctcaacggcg agttgtcgcg tttgtttcag       420
     gaagtctttt cggtagccaa gcggatccgt acggaaaccg gtatcggtgc taacccggtg       480
     tctgtggcct atgcggcagt ttcgtttgcg cgtcacattt ttgctgacct gaaaaaaagc       540
     cgggcgctgc tgattggtgc cggtgaaatg attgagctgg tggcgcgaca tttgagtgag       600
     cagcaggtgc aggaaattac cattgccaat cgcactcagg agcgagcctc ggagttggcc       660
     gccgccgtgg gggggcgtgg tatcagccta gaagaattgc cggtggcgct ggagcgtgcg       720
     gatatcctga tctcatgcac cgctgcgccg ttgccgatta tgggcaaggg tatggtggag       780
     cgggcgctga aaaaacgccg tcaccgaccc atgtttatgg tggatattgc cgtgccacgg       840
     gatatcgaac cggaagtggg cgaactgggt gatgtctacc tgtatacggt ggaccatctg       900
     caagaagcga ttcaggaaaa tgtccgttct cgtcagcagg cggcccagga ggcctcagag       960
     ctgattcgag atgccattgt gcgccaccgt cgtcagcgcc gtgaacagga tgccgttaag      1020
     gtgctgcgtg attatcgtga gcagcgcaag gctatggcgg aaagcgaact ggaaaaagcg      1080
     ttgcagcagt tgcgcaatgg tggcgatgcg gagcaggtgc tgcgcaggtt tcagcattcg      1140
     ctggtgaaca agtggctgca ttcccccagc gtgaccttgc gcaaaatggc cgcggatggc      1200
     cgcgccgaag ccctgttgct ggctcgtgag ttgctgctcg acgacgacca gtcgtag         1257
//

If you have problems or comments...

PBIL Back to PBIL home page