(data stored in ACNUC7421 zone)

EMBL: AM286690.HNS

AM286690.HNS         Location/Qualifiers
FT   CDS_pept        complement(6297..6653)
FT                   /transl_table=11
FT                   /gene="hns"
FT                   /locus_tag="ABO_0005"
FT                   /product="DNA-binding protein H-NS"
FT                   /function="play a role in the formation of nucleoide
FT                   structure"
FT                   /note="(type IV pili sensor histidine
FT                   kinase/responseregulator PilL/ChpA fusion protein)
FT                   identified by match to TIGR protein family HMMTIGR01387
FT                   InterPro: H-NS histone family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15453"
FT                   /db_xref="GOA:Q0VT26"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT26"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01387"
FT                   /protein_id="CAL15453.1"
FT                   /translation="MSINLDQLSVDELEKLIKQAESALDKKRKAELKNAQAVLEKMAKN
FT                   LGVAPQDLLKSSTEKKKTTRKNAAKKKTGVRRPAKVKFRDPNNSGNTWTGRGKRPLWLQ
FT                   DALSKGAKLEDFAV"
     atgagcatta atcttgacca attgtctgtc gacgaactgg aaaaactgat taagcaggca        60
     gaatccgcgc tagataaaaa gcgtaaagcc gaattgaaaa atgcccaggc tgtactggag       120
     aaaatggcca aaaatttggg tgtcgctcca caggatctgc tgaaaagttc tactgagaag       180
     aaaaaaacta ctcgcaagaa cgccgcaaaa aagaaaaccg gagttcgtcg tccggcaaaa       240
     gtaaaattcc gcgaccctaa caacagtggc aatacctgga ccggtcgcgg caaacgcccg       300
     ctgtggttgc aggatgccct gagcaaaggc gccaagctgg aagattttgc ggtataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page