(data stored in ACNUC7421 zone)

EMBL: AM286690.HRCA

AM286690.HRCA        Location/Qualifiers
FT   CDS_pept        339630..340559
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="ABO_0312"
FT                   /product="Heat-inducible transcription repressor hrcA"
FT                   /function="Transcriptional regulator of heat shock gene"
FT                   /note="Heat-inducible transcription repressor hrcA homolog
FT                   InterPro: Negative regulator of class I heat shock protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15760"
FT                   /db_xref="GOA:Q0VST8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST8"
FT                   /protein_id="CAL15760.1"
FT                   /translation="MSPATVRNIMSELEELGVLSSPHTSAGRVPTELGYRLYVDSLLAT
FT                   SVMERPDHRHLKKELRQLLAPEQSSQELIAQASKTLAELTRMAGLVAVPRREVSTLRQV
FT                   EFLPLSGKRVLVVLVVNRSEVQNRIIHTDRDYDGVELRQAANYINHTYAGWDLNSICDG
FT                   LLDTMNTDRQQMDALMQTAVAVADKALRTERPDSDYVVSGESNLIQTAEAENLGQLRNL
FT                   FDAFNHKRDILHLLERSMKADGVQIFIGRESGFQPFEDYSLISAPYTTDDGPMGVLAVV
FT                   GPTRMDYGKVIPTVDITAKILSAALTQL"
     gtgagtcctg ccactgtgcg caatatcatg tcggagcttg aagagttggg ggtgttgagt        60
     agcccgcaca cttcggcggg gcgagttccc acagagctgg gttaccggct gtacgtggat       120
     tcgctattgg cgaccagcgt gatggagcgc ccggatcatc ggcatttgaa aaaagagctg       180
     cgtcagttgc tggcgccgga gcagtcttcc caggagttga tcgcccaggc atcgaaaacc       240
     ctggcggaat tgacgcgcat ggccgggctg gtggcggtgc cccgtcgcga ggtgtctact       300
     ctgcgccagg tggaatttct gccattgtcg ggcaagcggg tgctggtggt gctggtggtc       360
     aatcgctccg aagtgcagaa ccggattatt cataccgacc gggattacga tggagtggaa       420
     ttgcgccagg cggctaacta catcaaccat acctatgcag gctgggactt gaacagcatt       480
     tgcgatggtt tgctcgatac catgaatacg gatcgccagc agatggatgc gctgatgcag       540
     acggcggtgg ctgtggcgga taaggcgctg cgtactgagc gtcccgactc tgattatgtg       600
     gtatccgggg aatccaacct gattcagacc gctgaggcgg aaaatttggg gcagctacgt       660
     aacttgtttg atgcctttaa tcataagcgt gacattttgc atttgcttga acgctccatg       720
     aaagccgatg gggtgcagat ctttatcggc cgagaatcag ggtttcagcc gtttgaggat       780
     tattcgctga tttccgctcc ttacacgacg gatgatggtc cgatgggggt gttggcagtg       840
     gttggtccca cccgcatgga ttatgggaaa gttatcccca ctgtggacat caccgctaag       900
     atcctctcag cggcgcttac ccagctttaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page