(data stored in ACNUC7421 zone)

EMBL: AM286690.HSLO

AM286690.HSLO        Location/Qualifiers
FT   CDS_pept        complement(302403..303257)
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="ABO_0276"
FT                   /product="chaperonin, 33 kDa"
FT                   /function="Disulfide bond chaperones of the HSP33 family"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01430 InterPro: Hsp33 protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15724"
FT                   /db_xref="GOA:Q0VSX4"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSX4"
FT                   /inference="protein motif:HMMPFAM:HMMPF01430"
FT                   /protein_id="CAL15724.1"
FT                   /translation="MQDHKQRFLFPDSDIRGELVQLESSISRIIEGQNYPLPVQGLIGE
FT                   AVAAVALLASTLKFKGRLALQAQGKGPVSLLLAECSHDGELRALARHSDGQDWSHGDIQ
FT                   TLIGEGTMVITITPDQGRQYQGIVPLSGDTLAQCLQGYFQQSEQLPTRLWLASGNNRAA
FT                   GLLLQRLPNQLSTTDGNTQMWEHLEALASTLQMEELLNLDDQTILRRLFHDTPPQLPDA
FT                   QPLRFGCTCSRERNRNALISLGNQELQQLLEEDGEVTLTCDFCRHQEHFDAVDLAEMLR
FT                   ESR"
     atgcaagacc acaaacagcg ctttcttttc cccgactccg acattcgtgg tgagctggtt        60
     caactggaaa gtagcattag ccgtattata gaagggcaaa actacccact gccggtgcag       120
     gggttgatcg gcgaagccgt ggccgctgtg gcgttgctgg ccagcactct caaatttaag       180
     ggccggctcg ccctgcaagc ccaaggcaag gggccggtgt ctctgctact ggccgaatgc       240
     agccatgatg gcgagctgcg tgccctagcc cgccacagcg acggtcaaga ctggagccac       300
     ggcgacattc aaaccttgat cggtgaaggc accatggtaa tcaccatcac ccccgatcag       360
     gggcgccagt atcaaggcat cgtaccgctc agcggcgaca ctcttgccca atgcctgcag       420
     ggatacttcc aacaatccga acaactgccc acccggctgt ggctggccag cggcaacaat       480
     cgcgcggcgg gcctgctgct gcagcgcctg cccaaccagc tgtccaccac cgacggcaac       540
     acccagatgt gggaacactt agaggcgctg gcgagcaccc tgcaaatgga agagctacta       600
     aacctagatg accaaaccat cctgcgccgg ctgtttcacg acaccccacc ccagttgccc       660
     gacgcccaac ctctgcgctt tggctgcacc tgctcccggg aacgcaaccg aaatgcactc       720
     atttcccttg gcaatcagga attacagcaa ttactggagg aagacgggga agtcacgctg       780
     acctgcgact tctgtcgcca tcaggaacat tttgatgccg tggacctggc ggaaatgctc       840
     cgagaaagcc gatag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page