(data stored in ACNUC7421 zone)

EMBL: AM286690.LYTB

AM286690.LYTB        Location/Qualifiers
FT   CDS_pept        502784..503719
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="ABO_0462"
FT                   /product="LytB protein"
FT                   /function="catalyses the conversion of
FT                   1-hydroy-2-methyl-2-(E)-butenyl 4-diphosphate into IPP
FT                   (isopentenyl diphosphate) and DMAPP (dimethylallyl
FT                   diphosphate)"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00216 InterPro: LytB protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15910"
FT                   /db_xref="GOA:Q0VSD8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSD8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00216"
FT                   /protein_id="CAL15910.1"
FT                   /translation="MQIRLANPRGFCAGVDRAIDIVNRALEVFGPPIHVRHEVVHNRYV
FT                   VEDLRQRGAVFVEELHEVPDDAIVIFSAHGVSKAVQEEAKRRQLQVFDATCPLVTKVHM
FT                   EVIRYAREGRESILIGHAGHPEVEGTMGQYDKSYGGDIYLVEDEADVVALTVRDESKLA
FT                   FVTQTTLSVDDTARVIDALRQRFPAIIGPKREDICYATTNRQDAVRQLALECGLVLVVG
FT                   SVNSSNSNRLRELAERCGAEAYLIDEPSQIEASWLKGKAAVGVTAGASAPEDLVQQVIA
FT                   TLKNLGGEDAEEIPGREENIRFSMPKALRP"
     atgcaaattc gtctcgctaa tccccgcggt ttctgtgctg gcgtggatcg tgccatcgac        60
     atcgtcaatc gcgccttgga agtgtttggg ccgccgatcc atgttcgtca cgaagtggtg       120
     cataaccgct atgtggtgga ggatttacgc cagcgcggcg ctgtgttcgt ggaagagctg       180
     cacgaagtgc cggacgatgc cattgtcatt ttcagtgccc acggtgtctc caaagcggtg       240
     caggaagagg ccaagcgtcg tcagctgcag gttttcgatg ccacttgccc tctggtcact       300
     aaggtgcata tggaagtcat ccgttatgcc cgcgagggac gcgaaagcat cctgataggc       360
     catgccggtc acccagaagt ggaaggcacc atggggcagt atgataaatc ctatggcggt       420
     gatatctatc tggtggaaga cgaagctgat gtggtggccc tgacggtgcg agatgaaagc       480
     aaattggctt tcgtgaccca aaccacactg agtgtggacg atactgcccg ggtcattgat       540
     gctctgcgcc agcggttccc ggccattatc ggccccaaac gcgaagatat ttgttacgca       600
     acgacgaacc ggcaggatgc cgtgcggcag ttggcgctgg aatgcggcct ggtgttggtg       660
     gttggttcgg tgaatagctc taattccaac cgcctgcgtg agctggccga gcgctgtggt       720
     gcggaggctt atctgattga tgagccgtcc caaattgaag cgagctggct gaaaggcaaa       780
     gccgccgtcg gcgtcaccgc cggagctagt gcgcctgaag atctagtaca acaggttatc       840
     gctaccctga aaaacctagg cggtgaggat gccgaagaaa tccccggccg cgaagaaaat       900
     atccgcttct ccatgcccaa ggcgctacgc ccgtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page