(data stored in ACNUC7421 zone)

EMBL: AM286690.MAF-1

AM286690.MAF-1       Location/Qualifiers
FT   CDS_pept        585647..586228
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="ABO_0533"
FT                   /product="maf protein"
FT                   /function="putative inhibitor of septum formation"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00172 InterPro: Maf-like protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15981"
FT                   /db_xref="GOA:Q0VS67"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS67"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00172"
FT                   /protein_id="CAL15981.1"
FT                   /translation="MILYLASGSPRRAELLQQIAVPFTVLPAPSIDETPRSAEAAVDYV
FT                   RRMAREKALVGQARMPTPGAVLGADTAVVLGDQILGKPADDTEALAMLTQLSGTSHQVI
FT                   SAVCVCSEGRQAVRHTVTTVQFRPFEAARLEVYVATGEGRDKAGSYGIQGLGGALVESL
FT                   SGSYSGVVGLPLEQTVELLEWADIPYWQID"
     atgattcttt accttgcctc cggttctcct cgccgtgctg aattgcttca gcagattgcg        60
     gttcccttta cggtgctacc ggcgccgtcc attgatgaaa cgcctcggtc ggccgaggcg       120
     gcagtggact atgtgcgacg tatggcccgc gaaaaggcat tggtgggcca ggctcgtatg       180
     cctacgcctg gtgctgtgtt gggggctgat acggcggtgg tactgggaga ccaaattctg       240
     ggtaagcctg ccgatgatac agaggcgctg gccatgttga cgcagctgag tgggacgtct       300
     catcaggtta tctcagcggt gtgtgtgtgc agtgaaggtc ggcaggctgt gcgtcacacg       360
     gtaacaaccg tacaatttcg accgtttgaa gccgcccggc tagaggtcta tgtggccacg       420
     ggtgaagggc gcgacaaagc gggcagttac ggcattcaag ggttgggtgg cgcactggtg       480
     gagtcgttgt ctggcagtta cagtggggtg gttggcctgc cgctggagca aacggtggaa       540
     ctgcttgaat gggccgacat tccttactgg caaatcgact aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page