(data stored in ACNUC7421 zone)

EMBL: AM286690.MMSA

AM286690.MMSA        Location/Qualifiers
FT   CDS_pept        22278..23777
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="ABO_0020"
FT                   /product="methylmalonate semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /function="2-methyl-3-oxopropanoate + coa + nad(+) =
FT                   propanoyl-coa + co(2) + nadh"
FT                   /EC_number="1.2.1.27"
FT                   /note="(methylmalonate semialdehyde dehydrogenase)
FT                   identified by sequence similarity; putative InterPro:
FT                   Aldehyde dehydrogenase family distal valine metabolic
FT                   pathway"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15468"
FT                   /db_xref="GOA:Q0VT11"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT11"
FT                   /protein_id="CAL15468.1"
FT                   /translation="MAHQLPLLINGEFVASQTDQWIAVTNPATQQTLCEAPAATAEEME
FT                   QAIAAGKAAFQTWKEVPVSERARLMLRYQALLKEHHDEIAEILSQETGKTFEDAKGDVW
FT                   RGIEVAEQAANIASLMMGETVENVARSIDTHSWTQPLGVCAGITPFNFPAMIPLWMFPL
FT                   AIAAGNTFVLKPSEQDPMTPNRLAELFQEAGAAPGLLQVVHGGKEQVDTLLRHPDIKAV
FT                   SFVGSVPVGQHVYRTATDNMKRAQCFAGAKNHMVIMPDANKEQVVSSLVGSSCGAAGQR
FT                   CMAISVAVFVGDSKAWIDELASQFAQIRPGAWNDPEAAYGPQISPAAKQRVLSMIEQGK
FT                   KEGATCLLDGSDCTVEGLPDGNWVGPTLFTDVTTDMAIYREEIFGPVLCCVCVDSLEEA
FT                   LELVNSSPYGNGTSIFTANGAAARKYQHQVEVGQVGINVPIPVPLPFFSFTGWKGSFYG
FT                   DQHAYGKQGVRFYTETKTVTSRWFDSDIPVAAGPNMSINLK"
     atggcccacc aattaccttt gctgattaat ggcgaatttg ttgccagcca aactgaccag        60
     tggattgcgg taaccaaccc ggccacccag cagacgctgt gcgaagcccc ggcggccacc       120
     gccgaggaaa tggagcaggc cattgcggcg ggcaaggcgg ccttccaaac ctggaaagag       180
     gtgccggtgt cggagcgagc gcgcttgatg ctgcgctatc aggcgctgct gaaagaacat       240
     cacgatgaga ttgccgagat tctcagccag gaaaccggca aaacctttga ggatgccaag       300
     ggcgacgttt ggcgtggcat cgaggttgca gaacaggccg ctaacatcgc gtcgttgatg       360
     atgggcgaaa ccgtggagaa cgtggcgcgt agcatcgata cccactcctg gacccagcct       420
     ttgggagtat gcgcggggat taccccgttc aacttcccgg ccatgattcc cctatggatg       480
     ttcccactgg ccatcgccgc cggtaatacc tttgtgctca agccttccga gcaagatccg       540
     atgacgccga atcgactggc agagttattt caagaggctg gcgcagcgcc aggcttgtta       600
     caggtggtgc acggcggtaa ggagcaggtc gatacgttgc ttaggcatcc tgatattaaa       660
     gcggtatcgt tcgtgggttc cgtgccggtg gggcagcacg tgtaccgcac cgcaaccgac       720
     aacatgaagc gcgcgcagtg cttcgccggc gctaaaaatc acatggtgat catgccggat       780
     gccaacaagg aacaggttgt tagtagcctg gtgggttctt cttgtggggc tgcgggtcag       840
     cgctgcatgg cgatcagtgt ggcggtgttc gtgggcgatt caaaagcctg gatcgatgag       900
     ctggccagcc agtttgctca aattcgtccg ggggcatgga atgacccgga agcggcctat       960
     ggcccgcaga tcagcccggc cgccaaacag cgagtgctga gcatgattga acagggcaaa      1020
     aaagaaggcg ctacctgttt gctggatgga tcagattgca ccgtggaagg tctgccagac      1080
     ggtaactggg ttggcccaac gttattcacc gatgtgacta ccgacatggc aatttaccgc      1140
     gaggaaattt ttggcccggt gttgtgctgc gtttgtgtgg actcactaga agaagccttg      1200
     gagctggtta acagcagtcc ctatggcaat ggtacttcca tttttaccgc caacggcgct      1260
     gcggcacgta aatatcagca ccaagtagaa gtcgggcaag tgggtatcaa tgtgccgatt      1320
     cctgtgccgc tgcccttctt cagcttcacg ggatggaagg gctctttcta tggtgatcaa      1380
     cacgcttatg gcaagcaagg cgtgcgtttt tatacggaaa ccaagacggt tactagccgc      1440
     tggtttgact ccgatatccc ggttgcggcg ggacccaata tgagcatcaa cttgaagtaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page