(data stored in ACNUC7421 zone)

EMBL: AM286690.MRED

AM286690.MRED        Location/Qualifiers
FT   CDS_pept        585027..585518
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="ABO_0532"
FT                   /product="rod shape-determining protein MreD"
FT                   /function="involved in the rod shape determination"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF04093"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15980"
FT                   /db_xref="GOA:Q0VS68"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS68"
FT                   /inference="protein motif:HMMPFAM:HMMPF04093"
FT                   /protein_id="CAL15980.1"
FT                   /translation="MVSDRPAGTGVIIVTLLLAALLEVIPLPASIDWIRPEWMLLVLVY
FT                   WVLVLPHRIGVLWGFFVGLYHDVLVGTTLGQWGLATALGAFVMLAAYKRMRVFNGLQQC
FT                   AVIFLLVGTVSLLAFLVQESVGRTLYPPYTILYSSVSSALVWRPVCAVLRWIQLRFLVR
FT                   "
     atggtcagtg atcgtcctgc cggtaccggc gttatcatcg ttaccttact gttggcggct        60
     ctgctggagg taatccctct acctgcgagc attgactgga ttcgcccgga atggatgcta       120
     ctggtgctgg tgtattgggt acttgtcctg ccgcatcgta ttggcgtgtt gtggggcttt       180
     tttgtggggc tttatcacga tgtgctggtg gggactacgc tgggacaatg gggcctggcg       240
     acagcgctag gcgcttttgt gatgctcgct gcgtacaagc gcatgcgagt gttcaacggg       300
     ctacagcagt gcgctgtgat tttcttgttg gtgggtacgg tgagcttgct ggctttcctg       360
     gtgcaggaat ccgtgggccg taccttgtat ccgccttaca ccattctcta ttcttctgtg       420
     tccagcgctt tagtgtggcg tccggtatgt gcggtgttac gctggattca gttgcgcttt       480
     ctagtacgct aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page