(data stored in ACNUC7421 zone)

EMBL: AM286690.MURA

AM286690.MURA        Location/Qualifiers
FT   CDS_pept        617117..618379
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="ABO_0560"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="cell wall formation. adds enolpyruvyl to
FT                   udp-n-acetylglucosamine (phosphoenolpyruvate +
FT                   udp-n-acetyl-d-glucosamine = phosphate +
FT                   udp-n-acetyl-3-o-(1-carboxyvinyl)-d- glucosamine)"
FT                   /EC_number="2.5.1.7"
FT                   /note="(UDP-N-acetylglucosamine1-carboxyvinyltransferase)
FT                   Alternate gene symbol: ttg2G; identified by sequence
FT                   similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16008"
FT                   /db_xref="GOA:Q0VS40"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS40"
FT                   /protein_id="CAL16008.1"
FT                   /translation="MDKLIITGGQRLDGDIRISGAKNAALPILAATLLADEPVTVGNLP
FT                   HLQDVTTLIELLGRMGVHVVIDDRMNVEVNATTIKELTAPYELVKTMRASILVLGPMVA
FT                   HFGKASVSLPGGCAIGSRPVDIHLRGLEAMGADIEVTNGYVNASVDGRLKGARIVMDVV
FT                   TVTGTENLMMAAALAEGTTYLENAAREPEVVDLADFINAMGGKISGAGTDTITIEGVER
FT                   LTGCHHQVIADRIETGTYLIAAAITGGRIKTKDTVPGTLDAVLQKLEEAGAKITTGDDW
FT                   IELDMQGRRPKAVSLRTAPYPAMPTDMQAQFMALNLVAEGTGTIVETIFENRFMHVQEM
FT                   NRMGADIEVQGNTAICRGVEQLTGAPVMATDLRASASLVIAALAASGETTVDRIYHIDR
FT                   GYECIEEKLQSLGAIIRRVPR"
     atggataaat tgatcatcac cggtggccag cggttggacg gcgacattcg catttctggg        60
     gccaagaatg cggcgctgcc gattctggca gccactttgt tggctgacga gccggtaacg       120
     gtgggcaacc tgccgcattt gcaggacgtg accaccctga tcgaattgtt gggccggatg       180
     ggtgtccatg tggtgatcga tgaccgcatg aacgtggaag tgaacgccac caccatcaag       240
     gaattgacgg ccccctatga gctggtgaaa accatgcgtg cctcgattct ggtgctgggt       300
     cccatggttg cgcattttgg taaagcatcg gtatcgctgc ccggcggttg tgctattggc       360
     tcgcggccgg tggatattca cctgcgtggc ttggaggcca tgggcgcgga tatcgaggtg       420
     actaacggtt atgtgaatgc ttctgtggat ggccggctca aaggagcacg catcgtcatg       480
     gatgtggtca ccgtaactgg taccgaaaac ttgatgatgg ccgcggcgct ggccgaaggg       540
     actacctatc ttgaaaacgc agcccgtgag cctgaagtgg tggatctggc cgatttcatc       600
     aatgccatgg gcggcaagat cagcggtgcc ggcaccgata ccattaccat cgaaggggtg       660
     gaacgcctga ccggatgtca tcatcaggtg attgccgatc gcatcgaaac cggtacctac       720
     ctgattgccg cggccattac tggtgggcgc attaagacta aagacacggt gccgggtacc       780
     cttgatgccg tactgcagaa actggaagaa gctggtgcga agattactac cggtgacgat       840
     tggattgagc tggatatgca aggccgtcgc ccgaaggcgg tgtcgttgcg cacagcccca       900
     tacccggcca tgcccactga catgcaggcc cagttcatgg ccctgaatct agtggccgaa       960
     ggcaccggta ctattgttga aaccattttt gaaaatcgtt ttatgcacgt gcaggaaatg      1020
     aaccgcatgg gcgcggatat cgaggtgcaa ggcaatacgg ctatttgccg tggcgtggag      1080
     caactcactg gagcaccggt gatggccacg gatttgcgcg cctctgcttc actggttatt      1140
     gcggcattgg ccgcgtccgg tgaaaccacc gtggaccgta tttaccatat tgatcgcggt      1200
     tatgagtgta tcgaagagaa actgcaatcg ctgggcgcga tcatccgtcg cgtaccacgc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page