(data stored in ACNUC7421 zone)

EMBL: AM286690.MURC

AM286690.MURC        Location/Qualifiers
FT   CDS_pept        657047..658471
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ABO_0599"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /function="UDP-N-acetylmuramoyl-L-alanine synthetase"
FT                   /EC_number="6.3.2.8"
FT                   /note="(UDP-N-acetylmuramate--alanine ligase) identified by
FT                   match to PFAM protein family HMMPF01225"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16047"
FT                   /db_xref="GOA:Q0VS01"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS01"
FT                   /inference="protein motif:HMMPFAM:HMMPF01225"
FT                   /protein_id="CAL16047.1"
FT                   /translation="MADNDIIHTVPEMRRIRGIHFVGIGGVGMCGIAEVLANQGYAISG
FT                   SDIKESPVLERLRSLGVRVDIGHRAENIDGADVVVTSTAVNTENLEVAAAHERRIPVVP
FT                   RAQMLAELMRFRHGIAVAGTHGKTTTTSLTAAIMAEAGLDPTFVIGGRLNSAGTNARLG
FT                   QSRYLVAEADESDASFLHLQPMSAIVTNVDADHMHTYGGDFAQLENTFIEFLHNLPFYG
FT                   VAVMCVDDPVVRKLLPRVNRQVIRYGFSEDADLRAENVRQDGMVTHFRVVRAEGEPLDV
FT                   SLNMPGRHNVLNALAAIAVSADEGAGDEAIIRGLNNFTGVGRRFDVQGDYHFDGGSATL
FT                   VDDYGHHPREVAATIDAIREGWPGRRLAMLFQPHRYTRTQDLYEDFVEVLSGVDVLLML
FT                   EVYAAGEEPIPGADARALCRSLRKRGLEPVFVDDPDKLQGLLASQLQNGDLLVTQGAGN
FT                   VGAIAKQLVAQGGGHG"
     atggccgata acgacattat tcatacggtg ccggagatgc gccgcattcg cggtatccac        60
     tttgtgggta tcggcggtgt gggcatgtgc ggcattgcgg aagtgctggc caaccagggt       120
     tatgccatca gcggcagcga cattaaggaa tcgccggtgc tagagcgtct gcgcagcctg       180
     ggtgtgagag tggacattgg ccaccgtgcc gagaatatcg atggtgcaga tgtggtggtg       240
     acctccaccg cggtgaatac cgagaacctg gaagtggcgg cggcccacga gcgccgtatt       300
     ccggtggtgc cacgggctca gatgttggcg gagttaatgc gctttcgtca cggtatcgcg       360
     gtggccggca cccacggcaa gaccaccact acgtcattaa ccgcagcgat catggcggag       420
     gcagggctgg acccgacctt tgtgattggt ggccgtttga atagcgcggg caccaatgcg       480
     cgcctgggac agagccgtta tctggtggcg gaagcggatg agtccgatgc cagtttcctg       540
     cacttgcagc ccatgagcgc catcgtcact aatgttgatg cggatcacat gcacacctac       600
     ggcggcgatt tcgctcagct ggagaatacc tttatcgagt ttcttcacaa cctgccgttc       660
     tacggtgtgg cggtgatgtg tgtggatgat ccggtggtgc gcaagctgct gccccgggtc       720
     aatcgtcagg tgattcgata tggcttcagc gaggatgcag acctacgtgc ggagaacgtg       780
     cgtcaggacg gcatggtgac tcatttccgg gtggtgcgcg cggaaggcga gcccctggac       840
     gtgtcgctaa atatgcccgg acgccataac gtgcttaatg cgctggccgc tattgcggtg       900
     tcggcggatg agggtgcggg cgacgaggcc attatccgtg gcctgaacaa ctttaccgga       960
     gtgggacgtc gctttgacgt gcaaggcgat tatcactttg acggcggcag cgcgacgctg      1020
     gtggatgact acggtcacca tccccgtgag gtggctgcca ccattgatgc cattcgtgaa      1080
     ggctggccgg gccgtcgcct agccatgctg tttcagcctc accgttatac ccgtacccaa      1140
     gacctttacg aggacttcgt ggaagtattg tccggtgtgg atgtattgct gatgttagaa      1200
     gtgtatgccg ctggggaaga accgattccc ggtgctgacg cccgtgcttt gtgtcgcagt      1260
     ctgcgcaagc gcgggctgga gcctgtgttt gtggatgacc cggacaagct gcaaggcttg      1320
     ttggccagcc agcttcagaa tggcgatctg ctcgtcaccc aaggcgcggg taatgtcggt      1380
     gccatcgcca agcagttggt tgctcaggga ggcggccatg gataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page