(data stored in ACNUC7421 zone)

EMBL: AM286690.MURF

AM286690.MURF        Location/Qualifiers
FT   CDS_pept        651049..652413
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ABO_0594"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alan
FT                   ine ligase"
FT                   /function="D-alanyl-D-alanine-adding enzyme"
FT                   /EC_number="6.3.2.10"
FT                   /note="(UDP-N-acetylmuramoylalanyl-D-glutamyl-2
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase) identified by
FT                   sequence similarity; putative InterPro: Cytoplasmic
FT                   peptidoglycan synthetases N-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16042"
FT                   /db_xref="GOA:Q0VS06"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS06"
FT                   /protein_id="CAL16042.1"
FT                   /translation="MMWLSQIAQWTGGALHGDDLKVNAVATDTRDIEPGCLFAALRGER
FT                   FDAHDFLASAKNGGAIAALVEHEQDCFDNVVQVADSRKGLGRLAGGYAAQFGMPRLAVT
FT                   GNAGKTTVKEMAATMLGEGTLATNGNFNNDVGVPLTLLRLRAEHRYAVIELGANAPGEI
FT                   AWTSSLTRPQVVLVTNVTGAHLEGFGSMQGIADAKAEIFTGCTQGGQAIVNNDDSFADF
FT                   FAEKARAAGLTVVRVSMDESTRAGADLYAENIVLHRDSAEFVLQPLGDAVLVPLPGAHQ
FT                   VSNALMACAAVRALGASLPQVLPRLAALKPVPGRMHIQSAGTGTVVDDTYNANPGSVRA
FT                   AIDWLAAQPAPQMLVLGEMGELGPQADSLVEALGEYAQQAGIAGLVVMTGAAAAARGYG
FT                   EAANIAKDYQQAANWSAPVLEQGGTVLVKGSRSAGMEAVVRLLATQEHTLTQGAR"
     atgatgtggc tgtcacagat cgcccagtgg accggcggtg ccctgcacgg tgacgacttg        60
     aaagtgaatg cggtcgccac cgatacccgc gatattgaac ccggctgtct gtttgccgcg       120
     ctgcgcggtg agcgctttga tgcccatgat tttctagcgt ctgccaaaaa cggtggcgcc       180
     attgctgctt tggtcgagca cgagcaggac tgtttcgaca acgttgtgca ggttgccgat       240
     agccgtaaag gtttggggcg acttgccggt ggctatgccg ctcagttcgg catgccccgc       300
     ctggcggtga ccggtaatgc cggcaaaacc accgtgaaag aaatggcggc gaccatgttg       360
     ggcgaaggta ccttggccac caatggcaat tttaataatg acgtgggtgt gccgctaact       420
     ctgctgcggc tgcgtgccga gcatcgttat gccgtgattg agctgggtgc caatgcaccg       480
     ggcgaaattg cgtggaccag ttcgttgacg cgcccgcagg tggtgttagt cacgaatgta       540
     accggggcgc atctagaggg ctttggctcc atgcagggca tagccgacgc caaggcagaa       600
     atttttaccg gttgtacgca gggcggtcag gcgatcgtga acaacgatga tagctttgcc       660
     gatttttttg cagaaaaagc ccgtgctgcg gggttgaccg tggtgcgggt gagtatggac       720
     gaaagcacac gggccggagc cgacctgtat gcagagaaca ttgtcctcca ccgcgacagt       780
     gccgagttcg tacttcagcc gctgggcgac gctgtgcttg tcccgctgcc gggggcgcat       840
     caggtgagta atgccctgat ggcctgcgca gcggtccgcg cgctaggtgc tagtttgcct       900
     caggtgttgc cgcgactggc agcgctcaag cccgtgcctg ggcggatgca tattcaatcc       960
     gccggcaccg gcacggtggt tgacgatact tataacgcta atccgggctc ggtacgtgca      1020
     gccatcgact ggttggccgc acagcccgca ccacaaatgc tggtgctggg agaaatgggt      1080
     gagttgggcc cgcaggcgga cagcctggta gaagcattag gtgaatacgc tcagcaggcc      1140
     ggcattgccg gtttggtggt gatgaccggt gcagcagcag ctgcacgggg ctatggcgaa      1200
     gcggcaaaca ttgctaagga ctatcaacag gcggcgaatt ggagtgcccc agtgctggaa      1260
     caaggtggca ctgtgttggt gaaagggtcg cgcagcgccg gtatggaagc ggtggtaagg      1320
     ctgttggcga cacaagaaca cacactcaca cagggggcac gctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page