(data stored in ACNUC7421 zone)

EMBL: AM286690.MURG

AM286690.MURG        Location/Qualifiers
FT   CDS_pept        655984..657057
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ABO_0598"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap
FT                   eptide)pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="(UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapep
FT                   tide) pyrophosphoryl-undecaprenolN-acetylglucosamine
FT                   transferase) identified by match to PFAM protein family
FT                   HMMPF04101 InterPro: Glycosyltransferase family 28"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16046"
FT                   /db_xref="GOA:Q0VS02"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS02"
FT                   /inference="protein motif:HMMPFAM:HMMPF04101"
FT                   /protein_id="CAL16046.1"
FT                   /translation="MSGTVLIMAGGTGGHVFPALAVADQLRTRGFDILWLGAENGMEGN
FT                   LVRQYGYEIAELSVSRLRGGGIKRKLTAPFNLLRAVLQARQLIRARQPVLAVGFGGFAS
FT                   GPGGLAARLCKVPVVVHEQNAVPGLTNRLLSRLSTVTLEGFQGAFGHPQACWVGNPVRP
FT                   QITALEEPARRYAQHQGGLRVLVLGGSQGALVLNQDLPELLLAVLGRDIQVRHQCGAGR
FT                   TAEAAPIYQALGLQAQVSEFIDDMAEAYGWADLVICRAGALTVAEVAAAGVAALFVPLP
FT                   SAVDDHQTLNARWLSERGAALLLPQRDLGAVSLAGTLKPVAERGLLAQIAERAREQAMA
FT                   DSAERAATLCEEVANGR"
     atgagtggca ccgtcctgat tatggctggc ggtacgggtg ggcatgtatt ccctgcgctg        60
     gctgtggctg accaactgcg cacccgcggt ttcgatattc tctggctggg cgcggaaaac       120
     ggcatggaag gcaacttagt gcgccagtat ggctacgaaa ttgccgaatt gtctgtgtcc       180
     cgcctacgcg gtggtggcat caagcgtaag ttgaccgcgc cgttcaacct gttgcgggcg       240
     gtgttacagg cgcggcagct gattcgcgcc cgtcagccgg tgctggcggt gggctttggt       300
     ggttttgcca gcggccccgg tgggctggct gcgcgcttgt gcaaggtgcc ggtggtggta       360
     catgagcaga atgcggttcc cgggctgact aatcgcttgt tgtctcgttt atcgacggtg       420
     accctggaag ggttccaggg tgcttttggt cacccgcaag cctgctgggt gggcaacccg       480
     gtacgtccgc agattactgc tctagaggag ccggctcgtc gttatgcaca gcatcagggc       540
     gggcttcgtg tgctggttct gggcggaagc caaggggcgc tggtacttaa tcaggatctg       600
     ccggaattac tattggcggt actgggtcgc gatatacagg tgcgccatca atgcggcgcc       660
     gggcgtaccg ctgaagctgc accgatttac caggcgctgg ggctgcaggc tcaggtgagt       720
     gaatttattg atgatatggc agaagcctac gggtgggcgg atttggtgat ctgccgggcc       780
     ggcgcactga ccgtggcgga agtggccgca gcgggcgtgg ccgccctgtt tgtaccactg       840
     cccagcgcag tggatgacca ccagacattg aacgcccgtt ggttgtcaga gcgcggggct       900
     gccctgttgc tgccccaacg ggacctgggt gcggtaagtc ttgctggcac cttgaaaccg       960
     gttgcagagc gtggcctgtt ggcgcaaatc gccgagcggg cccgtgagca ggcgatggcg      1020
     gatagtgcag agcgcgccgc cacgctgtgt gaggaggtgg ccaatggccg ataa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page