(data stored in ACNUC7421 zone)

EMBL: AM286690.NARG

AM286690.NARG        Location/Qualifiers
FT   CDS_pept        complement(602140..605880)
FT                   /transl_table=11
FT                   /gene="narG"
FT                   /locus_tag="ABO_0546"
FT                   /product="Respiratory nitrate reductase"
FT                   /function="second nitrate reductase enzyme which can
FT                   substitute for the nra enzyme and could allow to use
FT                   nitrate as an electron acceptor during anaerobic growth"
FT                   /EC_number="1.7.99.4"
FT                   /note="(Respiratory nitrate reductase 1 alpha chain)
FT                   identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15994"
FT                   /db_xref="GOA:Q0VS54"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS54"
FT                   /protein_id="CAL15994.1"
FT                   /translation="MSHFLDRLKYLGKKPTDFSDKHGETRDEDRHWEDGYRSRWQHDKI
FT                   VRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLY
FT                   SANRLKYPLIRQTLLKLWRDAIKEHCDPVDAWASIMETPDKAQQYKQARGMGGFVRGDW
FT                   DEMNRIIAAANIYTAKQYGPDRIIGFSPIPAMSMVSYASGARYLSLIGGVCLSFYDWYC
FT                   DLPPASPQTWGEQTDVPESADWYNSGYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAI
FT                   TPDYAEVSKLCDEWLSAKQGTDAALGLAMGHVILKEFHLNNPSEYFTDYVRRYTDMPFL
FT                   VELEPRDDGSYVPGRQLRASDFDASLGQDNNPEWKTVVWDPARDAPAVPRGSIGFRWGE
FT                   KGKWNLEPLDAAGNSITPLLTLADHHDNIAKVAFPYFGGIAREHFNHVAGDDILHHSLP
FT                   AKQLSLADGRQALVVTVFDLMCANYGIDRGFGDDDGATHYRQLKPYTPAWQEQITGVPA
FT                   EQVARIAREFADNADKTRGRSMIIVGAGMNHWYHMDMNYRGLINMLILCGCIGQSGGGW
FT                   AHYVGQEKLRPQTGWLPLAFGLDWTRPPRHMNGTSFFYNHSSQWRYEKLDVSELLSPLA
FT                   KPEDYQGSLVDFNVRAERMGWLPSAPQLGRNPLQIAREAQAAGKPVTDYVVEQLKSGNL
FT                   RFAAEQPDDPKNFPRNMFVWRSNLLGSSGKGHEYMLKYLLGTRHGLQGKDLGEMDGNKP
FT                   MEVDWVEQAPEGKVDLFTTLDFRMSTTCLYSDIVLPTATWYEKNDLNTSDMHPFIHPLT
FT                   AATDPAWQSRSDWEIYKGIARTFSQLCPGHLEEETDVVTLPLQHDAPSELSQSCVQDWK
FT                   KGECDLIPGKTMPSLVEVKRDYPATYERFTALGPLLDKLGNGGKGISWNTDKEIQFLGE
FT                   LNHTKQDGPAKGRPKIETAIDAAEVILSLAPETNGQVAIKAWQALSEFTGREHAHLARP
FT                   KEEEKIRFRDIVAQPRKIISSPTWSGLEDEHVSYTAGYTNVHELIPWRTLTGRQQLYQD
FT                   HPWMRAFGESLLVYRPPIDTKAVASAFSVPNGNPEKALNFLTPHQKWGIHSTYSDNLLM
FT                   LTLNRGGPVVWLSESDAADIGVADNDWVELYNANGSIAARAVVSQRVKDGMVMMYHAQE
FT                   RNVNVPGSEISGTRGGIHNSVTRVCPKPTHMIGGYAQLAYGFNYYGTVGSNRDEFVMVR
FT                   KMRNVNWLDGEGHDSIQEAVK"
     atgagccact ttctcgatcg tctgaagtac ttgggaaaaa aaccaaccga cttttcagac        60
     aaacacgggg agacccgtga cgaggaccgg cattgggaag acggctatcg aagccgctgg       120
     cagcacgaca aaatcgtgcg ctctacccat ggagtgaact gtaccggatc ctgcagctgg       180
     aaaatctacg tcaaaaacgg cctggtgacc tgggaaactc agcagacgga ttacccccgt       240
     actcgccccg acttacctaa tcatgaaccc cgaggctgtc cacgtggggc cagttattct       300
     tggtacctat acagcgccaa tcgcctaaag taccccctaa ttcgacagac cttgctgaaa       360
     ttgtggcgcg acgccattaa ggaacactgc gatccagtgg atgcatgggc ttccatcatg       420
     gaaaccccgg acaaagcgca gcaatacaaa caagcccgcg gcatgggcgg ttttgtgcgc       480
     ggcgactggg acgaaatgaa ccgtatcatt gccgcggcta acatttatac cgccaaacaa       540
     tatggacctg atcggatcat cggtttttct ccgatcccag ccatgtccat ggtgtcctat       600
     gcttccgggg ctcgctacct gtcactgatc ggcggggtct gcctgtcctt ctacgactgg       660
     tactgcgacc tcccccccgc cagcccacaa acctggggcg aacagaccga tgtgccagaa       720
     tccgccgact ggtacaacag tggctatatc attgcctggg gctccaacgt acctcaaacc       780
     cggaccccgg atgctcactt cttcaccgaa gtacgctaca aaggcaccaa gaccgtggcc       840
     atcacgcccg actatgccga agtttccaaa ttgtgtgacg aatggctgag cgccaagcag       900
     ggcacagatg ccgccctggg gttagcgatg gggcatgtca tcctcaagga attccatctc       960
     aacaatccca gtgaatattt caccgactat gtacggcgct acaccgacat gcccttcctg      1020
     gtggaactgg aaccccgtga cgacggcagc tacgttcccg gtcgtcaact ccgcgccagt      1080
     gatttcgacg catccctcgg acaggacaac aacccggaat ggaaaaccgt ggtgtgggac      1140
     cctgcccgag atgccccagc ggttccgcga ggctccattg gtttccgttg gggcgaaaag      1200
     ggaaaatgga acctagaacc actagacgcc gccggcaata gcatcacgcc actactcact      1260
     ctggccgatc accatgacaa catcgccaaa gtggcgttcc cctatttcgg cggcatcgca      1320
     cgtgaacatt tcaatcacgt ggccggtgac gacatcctcc accactcgct gcccgccaag      1380
     caactatccc tagcagatgg gcgacaggcg ctggtagtca ccgtgtttga tctgatgtgt      1440
     gcaaactatg gcatcgaccg agggttcgga gacgatgacg gtgccaccca ttaccgccaa      1500
     ctcaaacctt acacccccgc ttggcaagaa caaattaccg gggtccccgc tgaacaagta      1560
     gcacggattg cccgggagtt cgccgacaac gctgacaaga ctcggggccg ctccatgatc      1620
     attgtcggtg ccggcatgaa ccactggtac cacatggaca tgaattaccg agggctgatc      1680
     aacatgctga tcctgtgtgg ctgtattggt cagagcggcg gcggctgggc ccattatgta      1740
     ggccaagaaa aactgcgtcc gcaaaccggc tggttgcctc tggcctttgg cctggattgg      1800
     acccgtccgc cccgacacat gaacggcacc tcgtttttct ataatcattc aagccagtgg      1860
     cgttacgaaa agttggacgt cagcgagctg ctatcgccgc tggccaaacc agaggattac      1920
     cagggcagcc tggtggattt caatgtacgc gccgaacgca tgggttggct gccttcagcc      1980
     ccccaactcg ggcgcaaccc gttacagatt gcccgggagg cacaagcggc aggaaaaccc      2040
     gttacagatt atgtagtgga acagctcaag tctggcaacc tgcgttttgc cgctgaacaa      2100
     ccggatgacc caaaaaactt tccacgcaac atgttcgtct ggcgctccaa tcttctgggc      2160
     agctccggca aaggccacga atacatgctc aagtacttac ttggcacccg ccatggcctt      2220
     caaggcaagg acctgggcga aatggatggc aacaagccca tggaggtgga ctgggtcgag      2280
     caggcaccgg agggcaaggt ggatctattc accacgctgg atttccgcat gtccaccacc      2340
     tgcctgtatt ccgacattgt tctgcctacg gccacctggt acgaaaaaaa cgacctgaac      2400
     acctcagaca tgcacccttt tattcaccca ctcaccgcag ccaccgatcc ggcttggcaa      2460
     tcgcgcagcg actgggaaat ttacaaaggt atcgcccgca ctttttcaca actgtgcccc      2520
     ggtcatctgg aggaagaaac cgacgtggtc actctgccac tacaacacga cgccccgtca      2580
     gaactatcgc aaagctgcgt acaggactgg aaaaaaggcg aatgtgacct gatccccggc      2640
     aaaaccatgc cttcactggt tgaagtcaag cgggactacc ccgcaaccta tgagcgtttc      2700
     accgccttgg gaccgttact ggataaacta ggcaatggcg gcaagggcat ctcctggaac      2760
     accgacaagg aaatccagtt cctcggcgaa ctcaatcaca ccaagcagga cggcccggcc      2820
     aaagggcggc caaaaattga aaccgccatt gacgccgccg aagtcatcct ctctcttgca      2880
     ccagaaacca atggccaggt cgccataaaa gcctggcagg cattatcaga atttaccggt      2940
     cgagaacacg cacacttggc gcgccctaaa gaagaagaaa aaattcgttt ccgagatatt      3000
     gtcgcgcaac cgcgtaaaat tatctccagc cctacctggt caggtttaga ggatgagcac      3060
     gtctcctaca ccgcaggcta caccaatgtg cacgagctga tcccttggcg aaccctcact      3120
     ggccgccagc aactctacca agaccacccc tggatgcgag cttttggtga aagcctgctg      3180
     gtttaccgtc ctcccatcga caccaaagcc gtggccagtg cattcagcgt gcccaacggc      3240
     aacccagaga aggctctcaa tttcctgacg ccgcaccaga agtggggcat tcactccact      3300
     tacagtgaca acctgctaat gctgacgcta aatcgcggag gccctgtggt atggctatcc      3360
     gaaagtgatg cagctgacat tggtgtggcc gacaacgact gggttgaact gtacaacgcc      3420
     aatggctcca tcgctgcccg cgcagtagtc agtcagcggg taaaggacgg catggtaatg      3480
     atgtatcacg cccaggagcg caatgtgaac gtgcctggct cagaaatctc cggcacccgt      3540
     ggcggcattc ataactctgt aaccagagtc tgccctaaac ccacccacat gatcggtggc      3600
     tacgctcaac tagcctacgg attcaactac tacggcaccg tcggttccaa ccgcgacgaa      3660
     ttcgtcatgg tccgcaaaat gcgcaatgtg aactggctgg acggtgaagg tcacgacagc      3720
     atacaagagg ccgtaaaatg a                                                3741
//

If you have problems or comments...

PBIL Back to PBIL home page