(data stored in ACNUC7421 zone)

EMBL: AM286690.NARH

AM286690.NARH        Location/Qualifiers
FT   CDS_pept        complement(600590..602143)
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="ABO_0545"
FT                   /product="Respiratory nitrate reductase 1 beta chain"
FT                   /function="this is a second nitrate reductase enzyme which
FT                   can substitute for the nra enzyme and allows e.coli to use
FT                   nitrate as an electron acceptor during anaerobic growth.
FT                   the beta chain is an electron transfer unit containing four
FT                   cysteine clusters involved in the formation of iron-sulfur
FT                   centres. electrons are transferred from the gamma chain to
FT                   the molybdenum cofactor of the alpha subunit. nitrite +
FT                   acceptor = nitrate + reduced acceptor."
FT                   /EC_number="1.7.99.4"
FT                   /note="narH. Respiratory nitrate reductase 1 beta chain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15993"
FT                   /db_xref="GOA:Q0VS55"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS55"
FT                   /protein_id="CAL15993.1"
FT                   /translation="MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVE
FT                   TKPGIGYPKEWENQKKWNGGWMRRLGDGKIEPRIGGKWRVLANLFANPDLPEIDDYYEP
FT                   FDFDYQHLHTAKAGKHQPVARPRSLITGKRIKKIEWGPNWEEILGTEFAKRRKDINFEQ
FT                   VQADIYGQFENTFMMYLPRLCEHCLNPTCVASCPSGAIYKREEDGIVLIDQDKCRGWRM
FT                   CVSGCPYKKIYYNWKSGKSEKCIFCYPRIEAGEPTVCSETCVGRIRYLGILLYDADRIS
FT                   EVASTADERDLYHRQRDIFLDPNNPEVIAQAQRDGISDNVIAAAQASPVYKLAMDWGLA
FT                   LPLHPEYRTLPMVWYVPPLSPIQSAAQAGKIEYDGVLPRIESLRIPVRYLANMLTAGEE
FT                   QPVVLALKRLMAMRVYMRDKHVEGHINKEVVDAVGLSEQQVEEMYRYLAIANYEDRFVI
FT                   PSSHREQAREAFPERGGCGFSFGDGCHSGQSKSNLFGARPQTRTLVSPQTYDPQESPHE
FT                   "
     atgaaaattc gctcccaggt cggtatggtg ctcaatctcg acaagtgcat tggctgtcat        60
     acctgttccg tcacttgcaa aaacgtatgg accagccggg aaggtgtgga atacgcctgg       120
     ttcaataatg tggaaacaaa accgggcatt ggctacccga aagaatggga aaatcaaaaa       180
     aaatggaacg gtggatggat gcggcggctt ggcgatggga aaatcgagcc tcgtatcggc       240
     ggcaagtggc gagtgttggc caacctattt gccaacccgg atttaccgga aattgatgac       300
     tattacgagc ccttcgattt tgactatcag cacctgcata cggccaaggc cggcaagcat       360
     caacccgttg cacggccccg atcgctaatt acgggcaaac gtataaaaaa aatagaatgg       420
     ggtcccaact gggaagaaat cctcggcacc gagtttgcca aacgccgcaa agacatcaac       480
     ttcgaacaag ttcaggcaga catctacggc cagtttgaaa acaccttcat gatgtatctg       540
     ccacggctat gcgagcactg cctaaaccct acctgtgttg cctcctgtcc cagtggcgct       600
     atctacaagc gagaagaaga tggcatcgta ttgattgacc aggacaagtg ccgcggctgg       660
     cgcatgtgcg tatcgggctg tccctacaag aaaatttact acaactggaa aagcggaaaa       720
     tcagagaaat gcatcttctg ctacccacgt atcgaagcag gggagcccac cgtctgttcg       780
     gaaacctgtg ttggccgcat tcgttatcta ggcatactgc tctacgatgc cgaccggatt       840
     tccgaggtag cgagcaccgc cgacgaacgc gacctatacc atcgacaacg ggatattttc       900
     cttgatccca acaacccaga agtcatcgcc caggcacaac gcgacggaat ctctgacaac       960
     gtcattgccg cagcccaggc ttcgcctgtg tacaaactag ccatggactg ggggctcgcc      1020
     ctgccccttc acccggaata tcgcaccttg cccatggtct ggtatgtccc tccactctcc      1080
     ccaatccagt cagctgcgca agccggcaag atcgaatacg acggtgtact gccgcgtatc      1140
     gagtccttac gaattccagt gcggtatcta gcaaatatgc tcaccgcggg tgaagaacaa      1200
     cccgtagtgc tggccctcaa gcgcctgatg gccatgagag tttacatgcg tgacaagcat      1260
     gtggaaggtc acatcaataa ggaagtcgtt gatgccgtag gcctaagtga acagcaggtg      1320
     gaagaaatgt atcgctatct ggccatcgcc aactacgaag atcgcttcgt gattccctcc      1380
     agccaccgcg aacaggcgcg tgaagccttt ccggaacgcg gcggctgcgg tttcagtttc      1440
     ggcgacggtt gccacagcgg ccaaagcaaa agcaacctct tcggagcccg cccgcaaaca      1500
     cgcactctgg tcagccccca gacctatgac ccgcaggaga gcccccatga atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page