(data stored in ACNUC7421 zone)

EMBL: AM286690.NARK

AM286690.NARK        Location/Qualifiers
FT   CDS_pept        complement(605915..608554)
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="ABO_0547"
FT                   /product="nitrite extrusion protein"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15995"
FT                   /db_xref="GOA:Q0VS53"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS53"
FT                   /protein_id="CAL15995.1"
FT                   /translation="MVAEGMARAEQRRALVFSTFAFTLCFAVWTMLSILGLQIKDELNL
FT                   TDTQLGLLMATPVLTGSISRLFLGYLTDRFGGRKVFSLLMLLTGVFVFLLSLANTYWLL
FT                   LLGALGVGLAGGSFIVGVAYTSAWYPPEKQGTALGIFGAGNVGSAITSLCAPSLLLALG
FT                   WTGTAQLYAVVIAASGIFFLLFARTDPLSQQRAANPVSLKEQFAPLGELRVWRFSLYYF
FT                   FVFGGFVALALWLPHYLVEVYGLSITVAGVVAALYTIPASLFRILGGWLSDRYGARKVM
FT                   YWTLVVSVLCCFLLSYPPTDYVIDGVNGKLRFSMAMGLIGFIPLTMVLGFFMSLGKAAV
FT                   FKHIPAYYPNNVGTVGGLVGMVGGLGGFLLPLTFGMLNDVIGIWQSSFMLLFLVSAFAL
FT                   LWMHYSILRANRIELGEDIQSRDLPELSTPKAFVLDDWRPEEPAFWEEQGKRIAQRNLW
FT                   ISIPCLILAFSVWMVWSVVVAKLPSVGFDYSPNQLFWLAALPGLSGATLRIFYSFMVPI
FT                   FGGRRWTALSTASLLLPALWIGVAVQNPNTSYLVMLILALLCGFGGGNFASSMANISFF
FT                   YPKHEKGKAMGLNAGLGNLGVSLMQFVVPLIITTGVFSFVAGGPQITASNDAIWLQNAA
FT                   FVWVPFIVLATIAAWFGMNDIASAQSSFKDQATIFQRKHNWLMCVLYTGTFGSFIGFSA
FT                   GFPLLSANLFPEVDALKYAFLGPLVGALSRAFSGGVADRFGGGKVTLWVFIGMIVGVSG
FT                   TLFFLQKESFQGFFFMFLWLFFVSGVGNSSTFQMIPTIFSTSIPRIMPSLPQDQQRIQI
FT                   ERESAATVGFTSAIAAYGAFFIPKAFGTSLSLSGNANVALYGFILFYVLCLGITWFYYT
FT                   RKKAEIPC"
     atggttgcag aaggaatggc acgtgcggag caacgccgcg cgctagtctt ctcgaccttt        60
     gcgttcaccc tctgttttgc agtatggaca atgctgtcca tactcgggtt acagattaag       120
     gatgaactga acctcaccga tacccagctg ggcctgctca tggcaacccc agtgcttacc       180
     ggctccatca gccgattatt tcttggttac ctaaccgatc gttttggcgg ccgcaaggtg       240
     ttcagtctgc tgatgctgct cactggcgtc tttgtcttcc tgctgtctct ggccaacacc       300
     tactggttac tactgctcgg tgcgctgggc gttggcctag ccggtggctc ctttattgtt       360
     ggggtggctt acacttccgc ctggtatccc cccgagaaac aaggtaccgc gctgggcatc       420
     ttcggggccg gcaatgtggg ctcggcaatc actagcctgt gcgcgccctc cctgctactg       480
     gccttgggct ggaccggtac cgcccagctt tacgcggtag ttatcgccgc cagcgggata       540
     ttttttctgc tgttcgcccg cactgacccc ctaagccagc agcgtgctgc caacccggtc       600
     tctcttaaag agcaatttgc tccgcttggc gaactacgag tatggcgctt ttccctctat       660
     tacttctttg tgtttggtgg tttcgtcgct ctagcgctgt ggctgcctca ctatctggtg       720
     gaagtctacg gcttgagcat tactgtcgca ggtgttgtgg ccgccctgta caccattccc       780
     gcctcactat tccggattct cggaggctgg ctgtccgacc gctacggggc ccgaaaagtg       840
     atgtactgga ccctagtcgt gtcagtgctg tgctgcttcc tgctcagcta cccacccacc       900
     gactacgtca ttgatggcgt caacggaaaa ttacgcttct ccatggccat gggactgatc       960
     ggctttattc ccctaactat ggtattgggc tttttcatgt ccctgggtaa agcggcagtg      1020
     ttcaaacaca tcccggccta ctaccccaac aatgtgggta ccgtgggcgg cctggtgggc      1080
     atggtcggcg ggctcggcgg cttcctgctg cccctcacct tcggcatgct caacgatgtc      1140
     attggcatct ggcaaagcag cttcatgctg ctgttcctag tctcggcctt tgcgctactg      1200
     tggatgcatt actccattct gcgcgccaac agaatagaac tgggcgaaga tatacaaagc      1260
     cgcgacctgc ccgagctctc taccccaaaa gcattcgtac tggatgactg gcgtccggaa      1320
     gaacccgcct tctgggaaga acaaggcaag cgtattgctc agcgcaacct atggatatcc      1380
     attccttgcc tgatactggc attttcagtg tggatggtgt ggtctgtggt cgttgccaaa      1440
     ttacccagcg tgggctttga ctacagcccc aaccaactgt tctggctcgc tgctctgccc      1500
     gggttatccg gggcgactct gcgaatcttc tacagcttta tggtgccaat atttggcggg      1560
     cggcgctgga ccgctctttc caccgcgtca ctactgctgc cggcattgtg gattggtgtg      1620
     gcagtgcaaa acccaaacac ctcttacctg gtcatgctga tcctggctct gctatgcggt      1680
     tttggtggcg gcaactttgc ttccagcatg gccaacattt ctttcttcta tcccaagcat      1740
     gagaaaggca aggccatggg ccttaatgct gggctaggaa acttgggggt cagcctgatg      1800
     caatttgtgg tgcccctgat catcaccacc ggggtattca gcttcgtggc aggtggccca      1860
     caaattaccg ctagcaacga cgccatatgg ttgcagaacg ccgcctttgt ctgggtcccc      1920
     ttcattgtct tggcaaccat tgccgcctgg tttggaatga acgatatcgc cagtgcgcaa      1980
     tcttcgttta aagaccaagc caccattttc cagcgtaagc acaattggct aatgtgcgtg      2040
     ctctacaccg gaacgtttgg cagttttatc ggcttttccg ccggcttccc gttactcagc      2100
     gccaacctgt tcccagaagt cgatgctctc aagtatgcct ttcttggccc actggttggc      2160
     gcccttagcc gcgcgttttc aggcggcgtt gccgaccgct ttggcggcgg caaggtcaca      2220
     ttatgggtct ttatcggcat gatcgttggc gtgagcggga cgctgttttt cctgcaaaaa      2280
     gaaagttttc agggtttctt tttcatgttc ctgtggctgt tcttcgtttc cggggtaggc      2340
     aactccagca cgttccaaat gatccccacc attttctcca cctcgatccc gcgcatcatg      2400
     ccttcgctac cgcaagacca gcagcgtatt caaatcgagc gtgaatcagc ggccaccgta      2460
     ggcttcacct cggctatcgc cgcctacggg gccttcttca tccccaaggc gttcggcaca      2520
     tcactgagtc taagcggtaa tgccaatgtg gcgctgtacg gtttcattct cttttacgtg      2580
     ttgtgcctgg gtattacttg gttctactac acacgcaaga aggctgagat tccgtgttga      2640
//

If you have problems or comments...

PBIL Back to PBIL home page