(data stored in ACNUC7421 zone)

EMBL: AM286690.NUSA

AM286690.NUSA        Location/Qualifiers
FT   CDS_pept        358688..360265
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ABO_0328"
FT                   /product="transcription elongation factor"
FT                   /function="participates in both the termination and
FT                   antitermination of transcription. interacts with rna
FT                   polymerase and binds rna (by similarity)."
FT                   /note="identified by sequence similarity. InterPro: S1 RNA
FT                   binding domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15776"
FT                   /db_xref="GOA:Q0VSS2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSS2"
FT                   /protein_id="CAL15776.1"
FT                   /translation="MLGCSPASIEYALKNFSLCKGLAMNKEILLVAETVSNEKGVSRDV
FT                   IFEAIELALAAATKKRFKQEDVEIRVDIDRESGNARSFRVWHVVPDEELFEFGKQLTLD
FT                   EAHEQDTSLQIGDIWEEEVESEAFGRIAAQTAKQVIVQKVREAERRQIVEEYRDRIGDL
FT                   VSGTVKKASRDSIVLDLGGNAEALITREHMIPREAVRQNDRVRAYLLGVNEENRGPQLF
FT                   ASRACPDMLVELFKIEVPEIGEELIEIKGAARDPGSRAKIAVKTNDQRIDPVGACVGMR
FT                   GARVQAVSNELAGERIDIVLWDDNPAQLVINAMQPAEVASIVMDEESHSMDIAVEDESA
FT                   LAQAIGRSGQNIRLASELTGWELNVMTIDDAESKQEQEAEQALQTFINELEVDEDVAGV
FT                   LVDEGFSTLEEVAYVPEEEMLAIDGFDEEIVELLRQRAKDALLTKALVSEEKFDQAEPA
FT                   EDLLNMEGMDRELAVELASRDIVTMEDLAEQAVDDLLEIEGLSEERAAELIMTARAPWF
FT                   EGEDEAGA"
     gtgctcggtt gcagccccgc ttcaattgag tacgccctga agaactttag tctttgtaaa        60
     ggcctggcca tgaacaaaga gatcctgctg gtagcggaaa ccgtatcaaa cgagaagggt       120
     gtaagccgcg acgtaatttt tgaggccatt gaactggctc tcgcggcagc taccaagaag       180
     cggttcaagc aagaagacgt ggaaattcgt gtggatattg accgtgagtc cggtaatgcc       240
     cgcagctttc gtgtatggca cgtagtgcct gatgaagaac tctttgaatt cggtaagcaa       300
     ctgacattgg atgaagccca cgagcaggat acgtctctgc agatcgggga catctgggaa       360
     gaggaagttg aatccgaagc ctttggtcgt attgctgcgc aaactgctaa gcaggtcatt       420
     gtacagaaag tacgtgaagc ggagcgtcgt caaattgttg aggaatatcg tgatcgcatt       480
     ggcgacttgg tcagtggcac ggtaaagaaa gccagccgtg attctatcgt gctggacttg       540
     ggcggcaacg ccgaagcact gattactcgt gaacacatga ttccccgtga ggccgttcgc       600
     caaaacgacc gtgtccgtgc ctatctgctg ggcgtaaatg aagaaaatcg tggtccgcag       660
     ctgtttgcca gccgtgcttg cccggacatg ttggtggagc tgtttaaaat tgaagtgcca       720
     gagatcggtg aagagctgat cgaaattaaa ggcgctgctc gtgatccagg ctcccgagcc       780
     aaaattgccg taaagaccaa tgatcagcgt attgatccgg ttggcgcttg cgtaggcatg       840
     cgtggtgcgc gggttcaggc cgtttccaat gagctggctg gtgagcgtat cgatattgtc       900
     ctgtgggacg acaaccccgc acagctagtg attaatgcaa tgcagccggc ggaagtggct       960
     tccattgtta tggatgaaga aagccattcc atggatattg ccgtggaaga tgagtctgca      1020
     ttggcccagg ctatcggccg tagtgggcag aacattcgcc tagcgtctga gttaaccggc      1080
     tgggaactca acgtcatgac cattgatgac gctgagagca aacaggaaca agaagccgag      1140
     caagccctgc aaacattcat caacgagtta gaagtagatg aagatgtggc gggtgtgcta      1200
     gtggatgaag gtttctctac ccttgaagaa gtggcctatg tgccagagga agagatgctg      1260
     gctatcgacg gctttgatga ggagatcgta gagcttttac gccagcgtgc caaagatgcg      1320
     ctgttgacta aagccctggt atctgaagag aagtttgatc aagccgagcc cgcggaagac      1380
     cttctcaaca tggaaggtat ggatcgcgag ttggctgttg aattggcttc ccgtgacatt      1440
     gttacgatgg aagacctcgc cgaacaggca gtggatgacc tgctggaaat tgaaggcctg      1500
     agcgaagagc gtgcagccga gttgattatg actgcgcgcg cgccttggtt tgaaggtgaa      1560
     gacgaagccg gggcgtaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page