(data stored in ACNUC7421 zone)

EMBL: AM286690.OXYR

AM286690.OXYR        Location/Qualifiers
FT   CDS_pept        complement(178689..179630)
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="ABO_0169"
FT                   /product="Activator of hydrogen peroxide-inducible genes
FT                   OxyR"
FT                   /function="Hydrogen peroxide sensor. Activates the
FT                   expression of a regulon of hydrogen peroxide-inducible
FT                   genes such as katG, gor, ahpC, ahpF, oxyS (a regulatory
FT                   RNA), dps, fur and grxA. oxyR expression is negatively
FT                   autoregulated by binding to a 43 bp region upstream of its
FT                   own coding sequence. oxyR is inactivated by reduction of
FT                   its essential disulfide bond by the product of grxA, itself
FT                   positively regulated by oxyR. Has also a positive
FT                   regulatory effect on the production of surface proteins
FT                   that control the colony morphology and auto-aggregation
FT                   ability."
FT                   /note="Hydrogen peroxide-inducible genes activator
FT                   (Morphology and auto-aggregation control protein).
FT                   (transcriptional regulator LysR family) identified by match
FT                   to PFAM protein family HMMPF03466"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15617"
FT                   /db_xref="GOA:Q0VTA3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA3"
FT                   /inference="protein motif:HMMPFAM:HMMPF03466"
FT                   /protein_id="CAL15617.1"
FT                   /translation="MHNGIQSNKCINAMTLTELRYLVALARERHFGHAAQACNVSQPTL
FT                   SAAIKKLEEQLGMPLFERRPREVVVTPQAEPIIAQAQRVLEQADLLSQMAMSQRDQLGS
FT                   PLRVGAIFTVAPYLFPTMVPRVRKAAAEMPLFIEENYTHVLRRKLEHGELDAIIVALPF
FT                   SGGGLVRARMYEESFSVLLPADHPWTKQKKIAPEQLLSETLLLLGEGHCFRDQVLELCP
FT                   AIDSQHQRNLVQIEGGSLETLRHMVAGGLGITVLPNSALHQHGYDKHTFAVRPFEEPVP
FT                   SRTIALVWRDSFPRPKAIEVLRQAVPKEGLSG"
     atgcacaatg gtattcaatc gaataagtgt atcaatgcca tgacattaac agaacttcgc        60
     tatctggtcg ccttagcccg ggaacgccac tttggccacg cggcccaagc ctgcaacgta       120
     agccagccaa ccctgagtgc tgccattaaa aaactggaag agcagctggg catgccactg       180
     ttcgagcgcc gcccccggga agtggtggtt acgcctcagg ccgaacccat tatcgcgcaa       240
     gcccagcgcg tgctggagca ggcggaccta ctttcccaga tggcaatgag ccagcgcgat       300
     cagcttggct caccgctgcg ggttggcgca atctttaccg ttgccccata tctctttccc       360
     accatggtgc cgcgggtccg caaagccgca gcggaaatgc cgctatttat cgaagagaat       420
     tacacccacg tattgcggcg caagttagag cacggcgagc tggacgccat catcgttgcc       480
     ctgccattct ccggtggtgg tttggtgcgt gcgcgcatgt acgaggagtc tttttcggta       540
     ctgctaccgg cagaccaccc ctggaccaag caaaagaaaa ttgcacctga acaactgctt       600
     agcgagactc tgctattgct cggtgaaggc cactgtttcc gcgaccaagt actggaactg       660
     tgccccgcca tcgattctca acaccaacgc aacctggtgc aaatcgaagg cggctcgcta       720
     gagactttgc ggcatatggt cgcgggcggc ctgggcatca ccgtgctgcc caattctgcc       780
     ttgcaccaac atggatacga caagcacact tttgcggttc gtccatttga agaaccagtg       840
     ccctcgcgga ccatcgcgct agtttggcgc gatagcttcc cacgccccaa agcaatcgaa       900
     gtattgcgac aggccgtacc caaggaagga ttgtcaggat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page