(data stored in ACNUC7421 zone)

EMBL: AM286690.PE106

AM286690.PE106       Location/Qualifiers
FT   CDS_pept        complement(114433..116460)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0106"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /function="COG: Methyl-accepting chemotaxis protein"
FT                   /note="Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15554"
FT                   /db_xref="GOA:Q0VTI9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTI9"
FT                   /protein_id="CAL15554.1"
FT                   /translation="MKFNSGALFEKLRGGAGEGNTLNIALYVGLAIFIVLALANFLLSA
FT                   TTANKAQENITRASEMRVISQQIAKNALEAAAGNADAFELLDKSQKGFQSAWNAVKDEQ
FT                   VSDPEAMARLQTLWDEVNANADVILKGEDTVLDLHEVADTLAQTIPSLQAEYEGVVEIL
FT                   VTTDAAPEQIAFAQRQSWLAERIVRSIAKVLEGGDGAVIAADSFGRDASLFGRIMNGMI
FT                   EGDAAMGIDQVNDPDALDYLAEIADLFDEFVNQSVDEILETAPELFQVRNAADTIFRRS
FT                   QDLLEESTNLNNQFENTTSGLFPSVWLGGVSAGLAVLFFFIIMAQRNRQAAKLKDELES
FT                   ENQRNQAAILRLLDELGDLADGDLTVQATVTEDFTGAIADSINYSIDQLRNLVQTINNS
FT                   AVQVASAAQETQSTAMHLAEASEHQAQEIAGASAAVNEMAVSIDQVSANAAESAAVAER
FT                   AVAIANKGAEVVQATIHGMDTIREQIQETSKRIKRLGESSQEIGDIVSLINDIADQTNI
FT                   LALNAAIQASMAGEAGRGFAVVADEVQRLAERSAAATKQIETLVKTIQTDTNEAVISME
FT                   ATTAEVVKGARLAQDAGVALEEIESVSKTLADLIQNISNAARQQAASAGHISNTMNVIQ
FT                   EITSQTSAGTTATARSIGNLAEMAQDMRNSVAGFRLPEHS"
     atgaagttca attcaggagc attgttcgaa aaactgcggg ggggcgcagg cgagggcaac        60
     acgctgaata ttgcccttta tgtaggccta gccatcttta tcgtactagc actggctaac       120
     tttctgctgt ccgccactac ggcaaacaag gcccaggaaa acatcacccg cgcttccgag       180
     atgcgggtga tctcccagca aattgccaaa aacgccctgg aagcggccgc cggcaacgcc       240
     gacgcctttg aattgctgga taaatcgcag aagggcttcc agtcagcctg gaacgccgta       300
     aaagacgaac aggttagcga ccctgaagcc atggcccgtc tgcaaaccct atgggatgaa       360
     gtgaacgcca acgccgacgt gattctgaaa ggggaggaca cagtactgga cctgcacgaa       420
     gtggcagata cgctggccca gaccatccct tccctacagg ccgaatacga aggcgtggtg       480
     gaaattctag tgaccaccga tgccgcccca gaacaaattg cttttgcaca gcgccagtcc       540
     tggctggctg aacgcatcgt taggtccatc gccaaagtgc tagaaggcgg cgacggcgcg       600
     gtaatcgctg cagattcctt cggccgtgat gccagcctgt ttggtcgtat catgaacggc       660
     atgattgagg gtgacgcggc catgggcatt gaccaggtaa acgaccccga tgccctggat       720
     tatctggctg aaattgctga cttgttcgat gaattcgtta accagtccgt ggatgaaatt       780
     ctagaaacgg cccccgagtt gttccaggta cgtaacgcag ctgacaccat cttccgccgt       840
     tctcaggacc tgttggaaga atccaccaac ctgaacaacc agtttgaaaa caccactagc       900
     gggctgtttc catccgtatg gctaggtggc gtgtccgcgg gtctcgcggt gctgttcttc       960
     tttatcatca tggcccagcg gaaccgccaa gcggcaaagc tgaaagacga actggaaagt      1020
     gaaaaccagc gtaaccaagc ggcaattcta cgtctgctcg acgaactggg cgacctagca      1080
     gacggtgacc taaccgtaca ggccactgtc accgaggatt ttaccggtgc cattgctgac      1140
     tccatcaact attccattga ccaactgcgt aatctggtac aaacgatcaa caactcggcg      1200
     gtacaggtcg cttccgcagc ccaagaaact cagtccacgg cgatgcacct ggccgaagcc      1260
     tccgagcacc aagcccagga aattgccggc gcctccgctg cggtgaacga aatggcagtg      1320
     tccattgacc aggtatccgc caacgccgcc gaatcagccg cggtagcaga gcgggcagta      1380
     gccatcgcca acaagggcgc cgaagtcgta caggccacca tccacggcat ggacaccatt      1440
     cgcgaacaga tccaggaaac ctccaaacgg atcaagcgtt tgggtgagtc ctcccaggaa      1500
     attggtgaca tcgtatccct gattaacgac attgccgacc agaccaacat tctcgccttg      1560
     aacgccgcca ttcaggcatc catggccggc gaagccggcc gaggctttgc agtcgttgcg      1620
     gatgaggtac agcgcctcgc agaacgctcc gccgccgcca ccaaacaaat tgaaaccttg      1680
     gtaaaaacta ttcagaccga taccaacgaa gccgttattt ccatggaagc taccactgcc      1740
     gaggtcgtaa aaggcgcgcg cttggcacag gatgcgggcg tggcactgga agaaattgaa      1800
     agcgtatcca aaaccttggc agacctgatc cagaacattt ccaacgcggc gcgtcagcaa      1860
     gcggcctctg cgggacatat ctccaacacc atgaacgtga ttcaggaaat cacctcacag      1920
     acctctgccg gtactactgc cacggctcgt tccattggta acttggctga aatggcccaa      1980
     gacatgcgta attccgttgc cggcttccgc ctaccggagc actcctga                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page