(data stored in ACNUC7421 zone)

EMBL: AM286690.PE123

AM286690.PE123       Location/Qualifiers
FT   CDS_pept        complement(131644..132744)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0123"
FT                   /product="fimbrial protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15571"
FT                   /db_xref="GOA:Q0VTH2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTH2"
FT                   /protein_id="CAL15571.1"
FT                   /translation="MIRLLLAIMGVLFMGLFSHSASAVGFCLNGPFDQNIVFQRSSGSV
FT                   AIPGDSSDSYSVVIEETSTYTGCISVGVIPTIYSEINSPFTNTGNFPPPSSVSLPAGFS
FT                   SQTASRLQVSSGIHLQTFYAIEKGPFTRYCGLNGNVCSGALLSLDVLSSITFHTYTVIT
FT                   FGTMNSFIGSSISQSGGIGRMEINTGLLGRINVDISATINYIFTRSSCDLATPSQTVTL
FT                   DPAMASSLTPGSYVSATPFDIQLVNCVPPRSLSDSGNSFSGSLIRVAFLPASGQLVAGS
FT                   TTDLRPLDQGMPGVAEGVAFQLRQRNTATPVTLDGQTTLTAPLGTRNPADTTETFELEA
FT                   GLVKVNGETVTAGNVSSAVTFEVEYR"
     atgattcgat tattactagc catcatgggt gttcttttta tgggcttatt tagccattcg        60
     gccagtgctg tcggtttctg cctgaacggc cccttcgatc agaacatcgt ctttcagaga       120
     tcatcagggt ccgtggccat tcctggcgat tcctctgaca gctactctgt cgtcattgaa       180
     gaaacatcaa cctataccgg ctgtatttcc gttggcgtca tccccactat ttatagtgaa       240
     atcaactccc ctttcaccaa tacaggaaat ttcccaccgc cttcaagcgt atcgttacct       300
     gctggattta gcagtcaaac cgcctcgcgg ttacaagttt cctctggaat acatctacaa       360
     actttttacg ccatcgaaaa aggtccattt actcgctatt gcggactcaa tggtaacgtt       420
     tgctctggag cgctattgag ccttgatgtt ctctcctcga taacatttca tacttatact       480
     gttatcacat tcggcaccat gaacagtttt atcggtagca gcatcagcca atcaggaggg       540
     attggtcgaa tggagatcaa caccggcctt ttggggagaa tcaatgtgga tatttccgcc       600
     accatcaact atatattcac tcgttcaagc tgtgatcttg ctacgccctc acaaaccgtc       660
     acgctggacc cagcaatggc ttcctcgcta acacccggaa gctatgtatc cgctacgcct       720
     tttgatattc agcttgttaa ctgtgtgcca cctcgatcac tctcagattc aggaaacagc       780
     ttttccggtt cactaatccg tgttgccttt ctacccgctt ctggtcagct ggttgcaggt       840
     tccaccactg accttcgacc ccttgatcaa ggcatgcccg gcgttgcaga aggtgtcgct       900
     tttcaactca ggcagcgcaa taccgctacc cctgtcacac tggatggaca aaccacgctt       960
     actgcccccc ttgggacacg caaccctgct gatacgactg aaaccttcga gctggaagcc      1020
     ggcctagtta aagttaatgg tgaaacggtg actgctggca atgtatctag tgccgtcacc      1080
     ttcgaagtcg aataccgctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page