(data stored in ACNUC7421 zone)

EMBL: AM286690.PE13

AM286690.PE13        Location/Qualifiers
FT   CDS_pept        14888..16369
FT                   /transl_table=11
FT                   /locus_tag="ABO_0013"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15461"
FT                   /db_xref="GOA:Q0VT18"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT18"
FT                   /protein_id="CAL15461.1"
FT                   /translation="MDDKGKTENLDGRCTGIAEPRFAVVGHPNKGKSSVVATLAQNDSI
FT                   AIAMEPGTTRDSHRYPMKVDDVTLYELIDTPGFQRPRKVLAWLQGHSLSASDRPDTVAA
FT                   FVTQHRDDPRYHDECELLRPIVEGAGIIYVVDGSVPYNREHEAEMNILRWTGRPSLALI
FT                   NQIGPDDHSAAWEAALGQYFQIVRRFDAVGAPFEKHLDLLRSFGQLAPHWREPLDAALE
FT                   YLQALKFGRDSQALECIADALIGMLGHQETARLGEFESAEPLLPKLQQRWQAWQREREQ
FT                   RLRGAVEDLYQHRRLQRQEDTLVTPEGGDLFSERTRQLWGISKNQLAAAGFGAGAVGGA
FT                   GIDAMALGHSLGAGALIGGLLGAAGSYYYSGKLTKLKFGPLSGGFREAVYGPLRDPQFA
FT                   YVVLGRALVHWYQVSQRNHAGRDVLVVTGADDHWLGQMERSHRNGLQKSLQALAQRRFE
FT                   PSKRQRLIEQLEWAQQAFAQWQLQAFQTTDETTTD"
     atggacgata aaggtaaaac agagaacctc gatgggcgct gcactggcat tgccgagcca        60
     cgctttgctg tagtgggcca ccccaataag ggtaaatcca gtgtagtggc gaccctagct       120
     cagaacgaca gcattgccat tgctatggag ccgggaacca cccgcgatag ccaccgttat       180
     ccgatgaaag tggatgacgt gacgctatat gaattgatcg ataccccggg ctttcagcgg       240
     ccccgcaagg tgttggcctg gctgcagggg cacagccttt ctgcctcgga ccggccagac       300
     acggtcgcgg cttttgtgac acaacaccgt gatgatcctc gctatcacga tgaatgtgaa       360
     ttgctgcggc ccattgtgga gggggcgggt atcatctacg tggtggatgg ctcggtgccc       420
     tataaccgtg agcatgaagc ggaaatgaat atactgcgct ggactggtcg gcccagtttg       480
     gcgctgatca atcagatcgg cccggacgat cacagcgccg cttgggaggc tgcactgggg       540
     caatatttcc agattgtgcg tcgcttcgac gcggtgggtg cccccttcga aaaacaccta       600
     gacttgttgc gcagctttgg ccagttagcc ccacactggc gtgagccgct ggatgcggcg       660
     ctggaatatt tgcaagcgct caagtttggt cgcgacagcc aagcgctgga atgtattgcc       720
     gacgcgttaa ttggcatgct cggccatcag gaaaccgccc ggctggggga atttgagagc       780
     gccgaaccct tgctgcctaa gctgcagcaa cgctggcagg cctggcagcg cgagcgcgag       840
     cagcgtttgc gaggagcggt ggaagatctg taccagcacc ggcgcttgca gcgtcaggag       900
     gacacgctgg tgaccccgga aggcggcgat cttttcagtg agcgcacccg gcagttgtgg       960
     ggcatcagca agaatcagct ggctgcggca ggcttcggtg ctggcgccgt gggcggcgct      1020
     ggaatcgatg ccatggcgct gggccattca ctgggcgccg gggcactcat tggtgggcta      1080
     ttgggtgccg ccgggagcta ttactacagc ggcaaactca ccaaactaaa attcggcccg      1140
     cttagcggcg gtttccgcga agcagtctac ggccccttga gagacccaca gtttgcttat      1200
     gtggtgctgg gccgggcgtt ggtgcactgg tatcaagtga gccagcgcaa ccatgctggc      1260
     cgtgatgtgc tggtggtaac cggtgccgat gaccactggc tggggcagat ggaacgaagc      1320
     catcgtaatg gcctgcaaaa gagcttgcag gcgctcgctc aacgccgctt tgaacccagt      1380
     aagcgccagc ggctgatcga acagttggag tgggctcagc aggcgtttgc ccagtggcag      1440
     ttgcaagcgt tccagacgac ggatgaaacg accacagatt aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page