(data stored in ACNUC7421 zone)

EMBL: AM286690.PE132

AM286690.PE132       Location/Qualifiers
FT   CDS_pept        142994..144067
FT                   /transl_table=11
FT                   /locus_tag="ABO_0132"
FT                   /product="LysM domain protein"
FT                   /function="may have a general peptidoglycan binding
FT                   function"
FT                   /note="Region start changed from 142733 to 142994 (-261
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15580"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE0"
FT                   /protein_id="CAL15580.1"
FT                   /translation="MMMKSVQRALTFGLVLAVSGMASAAVVLKDGHPSKYFVKNGDTLW
FT                   DISGRFLQEPWQWPEIWQINEEISNPHLIYPGDEIRLSYVDGEPRLSVKRGVEETVMSN
FT                   GTVKLTPRVREIANDQAIPAIPASAIQSYLKEGLVVDRQEIIEAPYLVGGRDRRVIFGE
FT                   GDTVYARDTKTQWEGLEQGYGFYRTGEQYVDPDTNEVLGYEARQIGLGRVSSHDDDMIS
FT                   LRVTDSSEDLRIDDRLFSTEDRRVRAVLYPSAPDTKIEAKVIRFFDRLNSVARNDVVVI
FT                   NKGLRDGLKEGNVLDIYGQGEVVRDRQQGDMVQLPRERTGSMVIFRVFDKVSYSLIMES
FT                   TRPIYMNDIAESPAGSY"
     atgatgatga aatcggtcca gcgcgccttg acctttggcc tggtgctggc ggtgtctggt        60
     atggcctccg cagcggtggt gctcaaagat gggcacccca gcaagtattt cgtgaaaaac       120
     ggcgataccc tttgggatat cagcggccgt tttttacaag aaccgtggca atggccagaa       180
     atctggcaga ttaatgagga aatcagtaac cctcacctga tatatcccgg tgacgaaatc       240
     cgcctttcct atgttgacgg tgaaccgcgc ctttcggtga agcggggcgt ggaagagacc       300
     gtgatgtcca atggtacagt gaaactcacc ccgcgggtgc gtgaaattgc caatgaccag       360
     gctattcctg ctattccggc tagtgccatc cagtcctatc tgaaggaagg gctggtggtc       420
     gatcgccagg aaatcattga agcgccttat ctggtgggtg gccgtgatcg acgtgtcatc       480
     ttcggtgaag gcgatacggt ctatgcccgt gacactaaaa cgcaatggga aggtttggag       540
     cagggctacg gtttttatcg gaccggtgaa cagtacgtgg acccggatac caatgaggtg       600
     ctgggctacg aagctcgtca aatcggcctc ggtcgagtgt ccagccacga tgacgacatg       660
     atttctctac gagtcaccga ctccagtgag gatctgcgaa ttgatgaccg cctgttctcc       720
     acggaagatc gccgtgttcg agccgtactg tacccgtctg caccagatac taagattgag       780
     gcgaaagtga ttcgcttctt cgatcgtctt aacagtgtgg cccgtaacga cgtagtagtg       840
     attaacaagg gcctgcgtga tggtctgaaa gaaggcaatg tgttggatat atatggtcag       900
     ggcgaagtgg ttcgtgatcg tcagcagggt gacatggttc agctgccccg cgagagaacg       960
     ggttccatgg tgatcttccg ggttttcgat aaggtcagct acagcttgat tatggagtcc      1020
     actcgaccta tttacatgaa cgacatcgct gaaagtccgg cgggtagtta ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page